KEGG   Komagataeibacter saccharivorans: CD178_02272
Entry
CD178_02272       CDS       T05634                                 

Gene name
tamB
Definition
(GenBank) Translocation and assembly module TamB
  KO
K09800  translocation and assembly module TamB
Organism
ksc  Komagataeibacter saccharivorans
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_02272 (tamB)
Transporters [BR:ksc02000]
 Other transporters
  Pores ion channels [TC:1]
   CD178_02272 (tamB)
SSDB
Motif
Pfam: TamB DUF748
Other DBs
NCBI-ProteinID: AXY23023
UniProt: A0A347WDT0
LinkDB
Position
2387612..2391814
AA seq 1400 aa
MPEQTATPAPPRRRYRTVLRAVAFGLGIPVGLVAVALGMVLVAGNTGIGQREIERRLPGL
TGGSVHLSGLGGRFPDALHVRHLELDDYRGAWLSIDDLQLDWSPLRLLTRQAVISNLSMA
RLSIPRLSEDDPAHPPKPEKESGESIHMGVSIHAVNVARIEVGAPIARIPAAFSLNGHAS
LADIAPVLDHFSVATLPPADIALKLARLDHPGSLDLDTRLDRRTVSLNLRAHEDAQGFLS
TLTQLPALAPLDLTLGLHGPRDQAELALALTTGAVKAGANGQVGLIDRHMALDVTASSTD
LVAGSGLSWQGASLKAHLGGTLNRPKGNGVFDIDRLTTDTAGFTSLHMVADGLSGQENGQ
PEHAAIHATLTGLRIPGSQPTLFAGEPVRLDLMWHPDATGGPVDLTLSHPLVQLAGQIMT
AGEMAATFHADLPDLAPLAAVGGTKLHGHAGLSGNVTLPGKGHDGRFGLDSKVVLDGGLP
IAVGLIGDKGQLNAAGTISRDRHGANTITFTSLAVQGSTLQLDASQLRLVTGTPLRVDAD
AHLGLSDLHVLAPTLHGKMQADLHAAGPVDDLMASVKTQASIAAGNTVAGDMQASASMAH
LPQVKQGALDISGTLDRAPIAVSARLDSNADDSRHMQVEHLGWKSLTGQADMTLPAGHVV
PSGTLDLHMTRLADLHELTGQDINGHLSATVRTTAATATAPAELDVNVDSALGAAMARVD
RLVLRGRVLDPVGTPTTDLDLVVDNAHFRDMSGHGHVTAKGPISGLNITAQSGVDTPWTG
AATLDTALLANVPGHSVTVHRLAAEARHEQVRLDAPLSVTYGKETAIDHLRATITPPHGQ
AGNVEASGRIAPTLDLHASITRLSPDLLTPFIANLQAQGMLSADARLTGTTTNPSGKVSV
HGTDLKYHTDYTSSLAPASLDATANLNAGMAQVDARLQAGTQVNLSLRGTAPVNRTGQLN
LQADGNLDLAVANAYLGAQGMQAGGNLQMGIGMRGTLGQPRMSGTLTLANGLFHDFGQGI
QLSAMRGTVNAMGDRLVISSLTAQAGKGTLAASGSYGVLQPGQPIDLHIHADNARPLASD
LITATLDGDLGVKGLLSSRIDATGDITLKQVDINIPDSLPTSVAHLNVIRPEDEKNAQTV
VHTSPLVVGLGLDVRSPGRFYVRGHGLNTEMHGRIHTGGTATAPVVTGAFSLVKGGFSLG
GISLDFSKGQVGFNGVGVTHAIDPTLDFVAERSTNDGTARLNVGGYASAPKITFSSSPPL
SQDQILAILLFGTDSQSLSATQMASIAAAVATLSGGSAFDPLGMVRKTLHLDRLQMSSSS
NGSGGNDTGAIEAGKYVMRGVYVGAKQATSGSGTQAQVQVDLTKRLKINTTVGTGGNVTG
FTTPENDPGSSIGLLYQFKY
NT seq 4203 nt   +upstreamnt  +downstreamnt
atgcctgagcagacagcaacacctgccccgccgcgtcgccgctaccgcacggtcctgcgt
gccgtcgccttcgggctgggaattcccgtggggctggtggccgtggcgctgggcatggtg
ctggtcgcgggcaataccggcatcggccagcgcgagatcgaacgccgcctgcccggcctt
acggggggcagcgtgcatctatcggggctgggcggacgttttcccgatgcgctgcatgtc
cggcatctggaacttgatgactatcgcggcgcgtggctgtcgattgatgacctgcaactg
gactggtcaccactgcggctgctgacccggcaggcggtcataagcaacctgtccatggcg
cggctgtccatcccgcgcctgagcgaggatgatcccgcccatccgccaaagccggaaaaa
gagtccggcgagagcatccatatgggtgtcagcatccatgcggtaaacgtggcgcggata
gaagtgggcgcgccgattgcccgcatacctgccgccttcagcctgaacggccatgccagc
cttgccgatatcgcgcccgttctggaccatttttccgtcgccaccctgccgcctgccgat
attgcgctgaagctggcccggctggaccatcctggcagtctggatctggatacccggctg
gaccggcgcaccgtatcgctgaacctgcgcgcgcatgaggatgcgcagggcttcctgtcc
acgctcacccaactgccagcccttgccccgctggacctgacgcttggcttgcatggaccg
cgcgatcaggcggaactggcccttgcgctgaccacgggggccgtaaaggcgggtgcgaac
gggcaggtggggctgatcgaccggcatatggcgctggatgtcacggccagcagtacggac
cttgtggcgggcagcggactgagctggcagggggccagtctcaaggcgcatctgggtggg
accctgaaccggccaaaggggaacggcgtgttcgatatcgaccgcctgacgaccgatacc
gccggttttacttcgctgcatatggtggccgatggattgagcgggcaggaaaatggccag
cccgaacatgccgccatccatgcgaccctgaccggcctgcgtattcccggcagccagccc
accctgtttgcgggtgaaccggtcaggctggacctgatgtggcatcccgatgcgacgggc
ggtccggttgacctgacgctatcgcacccgctggtccagcttgcgggccagatcatgacg
gcgggtgaaatggcggccactttccacgcggacctgcccgatctcgcgccactggcggct
gtgggcgggacgaaactgcacggtcacgccgggctgtccgggaacgtgacactgccgggc
aagggccatgacgggcggtttggtcttgacagcaaggtggtgctggatggcggcctgccg
atcgccgttggcctgatcggggacaagggacaactgaacgccgcgggcaccatcagccgc
gacaggcatggtgccaataccattactttcacctcgcttgcggtgcagggcagcaccctg
caactggatgcctcacagctccgtctggttacgggcacgccgctccgtgtggatgcggat
gcccatcttggcctgtctgatctgcatgtgcttgcgcccacgctgcatggaaagatgcag
gccgacctgcatgcggcgggacccgtggacgaccttatggccagcgtgaaaactcaggcc
agcatcgccgcgggcaatacggtggcgggcgacatgcaggccagcgcaagcatggcgcac
ctgccgcaggtgaaacagggggcactggatatttcaggcaccctggaccgtgcgcccatc
gctgtatcggcccgtctggacagcaatgccgatgacagccgccatatgcaggtggagcat
ctgggctggaaaagccttaccggtcaggcggacatgacgctgcctgcgggccatgtcgtg
ccatcgggaacgctggatctgcatatgacccgtcttgcggacctgcatgagctgaccggg
caggacataaacggtcacctgtcggccacggtgcgcaccacggccgccacggcaacggcg
cctgccgaactggatgtgaacgtggacagcgcgcttggcgccgccatggcgcgggtcgac
cggctggtgttgcggggcagggtgctggacccggtcggcacgcccacgaccgatctggac
cttgtggtggataacgcccatttccgcgatatgagtggtcatggccatgtgacggccaag
ggaccaatatccggcctgaacattacggcgcagtccggcgtggataccccatggacgggg
gccgccacccttgataccgcgctgctggccaacgttcccggtcactccgtaaccgttcac
cggctggcggcggaagcgcggcatgagcaggtgcgtcttgatgcgcctctcagcgtcacc
tatggcaaggaaaccgccattgaccacctgcgggccaccatcacgcccccccacgggcag
gcgggtaacgtggaagccagcggcaggattgcgcccacgctggacctgcacgccagcatc
acgcgcctctcgcccgacctgctgacgcccttcatcgcgaacctgcaggcacagggcatg
ctttcggccgacgcccggctgaccggcacgaccaccaacccttcgggcaaggtcagcgtg
catgggacggacctgaaatatcataccgattacacatcatcccttgcacctgcatcgctg
gatgcaacggccaacctgaatgccgggatggcgcaggtcgatgcccgtcttcaggcaggg
acgcaggtcaatctgtcgctgcgtggaaccgcgccggtcaacaggacgggacagcttaac
ctgcaggccgatggcaatctggaccttgcggtcgccaatgcctatctgggtgcgcagggc
atgcaggctggcggcaacctgcagatgggcattggcatgcggggcacgctgggccagccg
cgcatgagcggcacgctgacgctggcgaatgggctgttccacgatttcgggcaggggatc
cagctttccgccatgcgtggcacggtcaacgccatgggggacaggctggtgatttcctcc
ctgaccgcgcaggcgggcaagggaacgcttgcggcatcgggcagctacggggtgttgcag
cccggccagccgatcgacctgcatatccatgcggataatgcccgcccgctggccagcgac
ctgattaccgccacgctggatggtgatctgggtgtaaaggggctgctgtccagccggatt
gatgcgactggggacattaccctgaagcaggtggatatcaacattccggattccctgccc
acttcggtcgcccatctcaatgtcatccggccggaagatgaaaagaacgcacaaactgtt
gtccatacctcgccactggtggtggggctggggctggatgtgcggtcgccggggcggttc
tatgtgcgcgggcatgggctgaatacggaaatgcatggccgtatccataccggcggcacc
gccaccgcgccggtggtgacgggggctttctctctggtcaagggcggattctctctgggt
ggcatctcccttgatttcagcaagggacaggtggggttcaacggtgtcggcgttacccat
gccattgatcccacgctggatttcgtggccgaacgcagcaccaacgatggcacggcccgg
ctgaacgtaggcggctatgccagcgccccgaagatcacgttctcatcctccccgccgctg
tcacaggatcagattctggccatcctgctgttcggcacggattcgcagtcgctctcggct
acgcagatggcgtccatcgcggcggcggtcgcaacgctgagtggtggttccgccttcgat
ccgctggggatggtgcgcaagaccctgcatcttgaccggttgcagatgagcagttcatcc
aacgggtcaggcggaaacgataccggcgcgatcgaggccgggaaatacgtgatgcgcggc
gtgtatgtgggcgccaagcaggctacatcgggttccggcacgcaggcgcaggtgcaggtt
gacctgaccaagcggctcaagatcaatacgaccgtgggtacgggtggcaacgtgaccggc
ttcaccacgccggaaaacgatccgggcagcagtatcggcctgctgtaccagttcaagtac
tga

DBGET integrated database retrieval system