KEGG   Komagataeibacter saccharivorans: CD178_02591Help
Entry
CD178_02591       CDS       T05634                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ksc  Komagataeibacter saccharivorans
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CD178_02591 (ahpF)
Enzymes [BR:ksc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CD178_02591 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Glutaredoxin HI0933_like Thi4 DAO FAD_binding_3 AlaDh_PNT_C NAD_binding_8 GATase1_like
Motif
Other DBs
NCBI-ProteinID: AXY23338
UniProt: A0A347WEP5
LinkDB All DBs
Position
2733603..2735183
Genome map
AA seq 526 aa AA seqDB search
MLQDTIKTQLKAYLADLAHPVVLEASLDSSPKSREMHELLHEVAALSDRVQVSEQGEATR
RPSFVIRRDGAKTGVTFAAIPMGHEFTSFVLALLQAGGHPPKFTDDQIAQIRALPGHYNF
ETYVSLSCQNCPDVVQALNAMSVINPNIHNVTIDGGLFQDEVTARNIMSVPQVYLNGELF
DTGRMDITQILARLDANAPKRAAEQLRNVAPFDVLIIGSGPAGASAAIYAARKGLRTGLV
GERFGGQVMDTEGIENFISVKETEGPKLAAALEAHVRQYDVEIIPAQRAAELFPAVKPGG
LHGVALESGAILHSRTVILATGAHWRHLGVPGEEEYRNRGVAYCPHCDGPFYKGKRVAVA
GGGNSGVEAAIDLAGIVAHVTLLQRGSHLKADKVLQDKLHSLPNVTVLTEALTTRVEGNG
RNVTGLTYRGGDGADHHVDLEGVFVQIGLLPNTDWLKGTVRLNDFGEIVVDDHGATSVPG
VFAAGDATTTPYKQIVIAIGDGAKAALSAFDYLIRVPVAEEKRVPA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagacaccatcaagacgcagctcaaggcctatctggcagacctggcgcacccg
gtcgtgctggaggcatcgctcgacagcagcccgaaatcgcgtgagatgcatgaattgctg
cacgaggtcgccgccctttctgacagggtgcaggtgtccgaacagggcgaggccacgcgc
cgcccctccttcgtcatcaggcgcgatggggcgaaaaccggcgtgacattcgccgccatc
ccgatggggcatgagttcacgtccttcgtgctggcgctgttgcaggccgggggccacccc
cccaaattcaccgatgaccagatcgcccagatccgcgcgctgccgggacattacaatttc
gagacctatgtctccctgtcctgccagaactgcccggacgtggtgcaggcgctcaatgcc
atgagcgtcatcaaccccaacatccataacgtcacgattgacggcgggctgtttcaggac
gaggtcacggcaaggaacatcatgtccgtgccgcaggtctacctcaacggggaactgttc
gacaccgggcggatggatattacccagattctggccaggctggacgccaatgcccccaaa
cgtgcggcggagcagctcaggaatgtcgcacccttcgacgtgctgataatcggcagcggc
cctgcgggcgcttccgccgcgatctatgcggcgcgcaaggggctgcgcacggggctggtg
ggcgagcgcttcggcggtcaggtcatggataccgaaggcatcgagaatttcatttcggtc
aaggaaaccgaagggccaaaactggcggcggcgctggaagcacatgtgcggcagtatgat
gtggagatcatacccgcccagcgcgcggcggaactgtttccggcggtaaagcctggtggc
ctgcatggggttgcgctggaaagcggggcgatcctgcattcccgcacggtcatccttgcc
accggcgcgcactggcgtcacctcggcgtgccgggcgaggaggaataccgtaacaggggc
gtggcctactgcccgcattgcgatggcccgttctacaagggcaagcgggttgccgtggcc
ggtggtggcaacagcggcgtggaagcggcgatcgaccttgccggtatcgtggcccatgtc
acgctgctgcagcgcggatcacacctgaaggcggacaaggtgttgcaggacaagctgcac
agcctgcccaatgtcaccgtcctgaccgaggccctgacaacgcgggtggaaggcaacggc
cggaacgtgactggcctgacctatcgcggcggtgacggtgcggaccaccatgtcgatctg
gaaggggtattcgtccagatcggcctgctgcccaatacggactggctgaagggcacggtc
aggctgaacgatttcggtgaaatcgttgtggatgaccatggcgcgacatcggtgcccggt
gtctttgcggcgggtgatgcgaccaccacgccgtacaagcagatcgtgatcgccattggc
gatggcgcgaaggcggccctgtccgcattcgattacctgatccgcgtgccggtggcggaa
gaaaagcgcgtccccgcctga

DBGET integrated database retrieval system