KEGG   Komagataeibacter saccharivorans: CD178_02888
Entry
CD178_02888       CDS       T05634                                 

Gene name
gabP_2
Definition
(GenBank) GABA permease
  KO
K11735  GABA permease
Organism
ksc  Komagataeibacter saccharivorans
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_02888 (gabP_2)
Transporters [BR:ksc02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   CD178_02888 (gabP_2)
SSDB
Motif
Pfam: AA_permease
Other DBs
NCBI-ProteinID: AXY23634
UniProt: A0A347WFJ1
LinkDB
Position
complement(3068876..3070165)
AA seq 429 aa
MADKLAPRHLTMIAFGGLIGMGLLVGCGSAIHRAGPAIVLSILYAGMLTYCAMRTLSDYM
ALDPDRGSFLAYLGTSRRSGEEFVCGWLYCAYWTCVIAAEGLGGGMLLHQYLPLPVLPTA
LALIAAACALNLQSVRLFGQVEFYLTMVKLVAIMAFCAVCLGAVTVDLYHHGRQILHDLN
GIDLAPFGIGAAFYTVPTIMFTMAGAEIITIAHRETETSSQTLSGLARLVTVRMVAFYLV
PVLLILLILPLSSVRPGFSPFADTLAFLHVPHGKAVFDGVILVTLLSCINSSTYIASRVM
NELRTHDRDGTGMAPVSFASCIMGVSAAGGMLCVGATLFSAAAFSLLLDVSGYITIVVYG
VISLSFIRFATGRALSPMTRTRAFMALLLSAGVMSAVIGGDERRSGLECFFVLVLLLSVC
RVGMGRLGR
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcggataaactcgccccccggcatctgacgatgatcgcctttggcggcctgatcggg
atgggactgctggtcgggtgtggcagcgccatacacagggccggtcccgccatcgtgctg
agcatcctgtatgcaggcatgctgacatactgcgccatgcggaccctgtcggattatatg
gcgcttgacccggaccggggttcgttccttgcctatctgggcacatcgcgccgttcgggg
gaggagtttgtctgtggctggctttactgtgcgtactggacctgcgtcatcgcggcggaa
ggactgggtggggggatgctattgcatcagtatcttccgctgcccgtccttccgacggca
ctggcgctgattgcggcggcatgtgcgctgaacctgcagtcggtcaggcttttcgggcag
gtcgagttctatctgaccatggtcaagctggttgccatcatggcgttctgtgcggtttgc
ctgggggcggttacggtggacctgtatcaccatggccgtcagatcctgcatgatctgaat
gggattgatctggccccgttcgggatcggcgcggcgttctataccgtgccaaccatcatg
ttcaccatggccggggctgaaatcatcaccatagcccatcgggaaacggaaacatccagc
cagaccctttccggtctggcccgtctcgttacggtgcggatggtcgccttttatctcgtt
cccgtgctgcttatcctgctgatcctgccgttatcatctgtccggcccggattttcgccc
tttgccgatacgctggctttcctgcatgtgccgcatggcaaagccgtattcgatggtgtc
attctggttacgttactgtcctgtatcaattccagcacctatatcgcgtcccgcgtcatg
aatgaactgcggacacatgaccgggacggaacgggcatggcgcccgtgtcgttcgcatca
tgcatcatgggggtgtcggcagcgggtggcatgctctgcgtgggggcgacactgttcagc
gcggctgccttttcattgctgctggatgtcagtggctacatcaccattgtcgtttacggt
gtcatcagcctgtccttcatccgctttgcaacgggcagggcattatcgccaatgacaagg
acgcgggcctttatggcactgctgctcagtgccggtgtgatgtccgccgttattggcggt
gatgagcgacgcagcggcctggaatgcttttttgtccttgtcctgcttttatctgtctgt
cgtgtcgggatgggtcgtcttggccgttag

DBGET integrated database retrieval system