KEGG   Komagataeibacter saccharivorans: CD178_03166
Entry
CD178_03166       CDS       T05634                                 

Gene name
cysW
Definition
(GenBank) Sulfate transport system permease protein CysW
  KO
K02047  sulfate/thiosulfate transport system permease protein
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc00920  Sulfur metabolism
ksc02010  ABC transporters
Module
ksc_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CD178_03166 (cysW)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CD178_03166 (cysW)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_03166 (cysW)
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    CD178_03166 (cysW)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AXY23910
UniProt: A0A347WGB7
LinkDB
Position
unnamed1:200251..201054
AA seq 267 aa
MARFIFASAVYLLIGLIVILPVVLVFVMAFSHGLATALATFADPDALSAIRLTVIMTVLT
VAINTVFGVMAAWTLSRFRFPGRGALIVLIELPLSVSPVVGGLVWLLVFGTQGWWGAALE
RWGYPVMFAPPGILLATVFVTFPYVTRTLMPVMIHNGREGEDAAVLLGAGLWQILWHVTL
PGARLALLSGVLLTTARAMGEFGAVSVVSGHIPGLTETIPLHIETLYNGYQTVAAFTMAG
LLAIMAMLVVTARTLIERRAGARGLIA
NT seq 804 nt   +upstreamnt  +downstreamnt
atggcgcgcttcatattcgcatccgccgtgtacctgctgatcgggctgatcgtgatcctg
ccggtggtactggtgttcgtgatggcgttttcccacggtctggccaccgcgctggcgaca
tttgccgatcctgatgcgctgtcggccatacggcttacggtcatcatgacggtgctgacg
gtcgccatcaacaccgtgttcggcgttatggcggcgtggaccctgtcacgcttccgcttt
cccggccggggggcgctgatcgtgctgattgaactgccgctcagtgtatcacccgtcgtg
ggggggcttgtctggctgctggtgttcggcacgcaggggtggtggggggcggcgctggaa
cgctggggctatcccgtcatgttcgccccacccggtatcctgctggctacggtattcgtc
accttcccgtatgttacgcgcaccctcatgcccgtgatgatccataacggacgcgagggc
gaggacgcggccgtgctgctgggggcgggcttatggcagatcctgtggcatgtcaccctg
cccggcgcgcgccttgcgctgctgtcgggcgtgctgctgacaacagcgcgggcaatgggc
gaattcggcgcggtttcagtggtgtcgggccatattcccggcctgacggaaaccatcccg
ctgcatatcgaaaccctgtataacggttaccagacggtggccgccttcaccatggcggga
ctgctggcgatcatggccatgctggtcgtcaccgcccgcaccctgatcgaacgccgcgca
ggcgcaaggggactcatcgcatga

DBGET integrated database retrieval system