KEGG   Kangiella sediminilitoris: KS2013_1102Help
Entry
KS2013_1102       CDS       T04467                                 

Definition
(GenBank) Serine/threonine protein kinase with TPR repeats
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ksd  Kangiella sediminilitoris
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ksd01001]
    KS2013_1102
Enzymes [BR:ksd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KS2013_1102
Protein kinases [BR:ksd01001]
 Serine/threonine kinases: Other
  Bacterial family
   KS2013_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_12 TPR_2 TPR_1 TPR_19 TPR_16 TPR_8 TPR_17 TPR_MalT TPR_14 TPR_10 TPR_7 TPR_6 ANAPC3 TPR_11 APH TPR_21 RPN7 SNAP TPR_9 SHNi-TPR Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AOE49822
UniProt: A0A1B3BAI9
LinkDB All DBs
Position
1200263..1203646
Genome map
AA seq 1127 aa AA seqDB search
MGHNDLDPKTKSNSLKETQVLRELHTLNPGTLLIGRFEILSKQGCGRYGCVYKAKDRQLD
SFVAIKVLHQHLLNEQAIQSFKNEILILRQLSHQNIVRVHEYYQDEETHFITMDWIDGKS
LTDLINSQSTGFPVKKALGYMQQVLDALLVTEQKGISHCDLKPENILVDNEERVYVADFG
VASALSDTEEESIHGTPVYASPEYLELGQINKTTDTYSVGVILYELITGHTPFSSSTIND
LLQEKKRETFNGLPKKAAGSELSSLVSSCLAAEPKRRPQSLASLSERIAQLVNETPKRNR
ISYGYLSLAAIFSVVIIGSFYLLQKEDTRLSVSAEQKQMAKQGLAILPFKTEAMSNQLWL
TQGLPSVLSQELSQAPDLRVVGTARTKRTMDLLGYSRDLSDQKFVTLSELLQTPVFLDTS
IILIGPNKYRLKAEVVEVTGNNISRTQLLELQSSEQEFSKELKQLTESLNTFFSLSNITD
QLLMPEGLSIQKWSELEVLIKDGKLARAKKQLESLINNYPEFAQAHFLLGEVLLKSGEEQ
EAGEAFKKVKELTAPNQLIHQKSTIEQFLIAGDLESASTVYETILERLPKRDDIRFELAQ
LYINLEQLDKAEIELKHIVEEDQNHPVAWYELSKVAIWKGQTEKAVDDYLVKALVTAKKL
KNEQLRGDVLNAFGVAYHRLGELDLSLDYYQQGLEVRQSVGDSRGIVTSLSNLASIYAVK
GQYDKAEQNLYQAIEVNKPRNDALKQADLFNELGVIAEEQGQYKKALEHFRASLSIRMKL
DDDWLKAESLNNVAYIYFLLSDEEHATIYWEQAKNYYEKVKDPVGVVRVNENVGQLSLRK
GDWQSAFQIFSQAKEKSESLSLFEERVVAEAYLAKLALLKGNFEAPLEKLKEIKATLSER
DDIRGQIEFGIWLADWNIISGNYSEASRLLQLLEPLLSKEHNRSQQMIFHVLKSKLKLYQ
GESVSLDESDLPDADGLTSKASLKLLLFKLEKALFTSDVSKAEFNDLVAAIESYDLALHQ
FALLEYLQLKAIYYIKINDYKKLEVSVNQLRELRKSLGSHWSDFISERIISNYYQLTSDD
VKAQEYGQLAVSKFKELLEELPEEQQKNLISLHGRYIFPDDFMEKLL
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgggtcataatgacttagatcctaagactaagtctaattctctaaaagagacacaggtt
ttaagagagcttcatactttaaacccaggcactttgctaattggtcgtttcgaaatactc
tcaaagcagggttgcggccgttatgggtgtgtctacaaagccaaagaccgacaacttgat
tcttttgtcgctataaaggtcttacatcagcatttactaaatgaacaggcaattcagagc
ttcaaaaatgaaatcctgatccttagacagttatcccatcaaaatatcgttcgtgtccat
gagtattatcaggatgaagagactcatttcattaccatggactggattgacggtaaaagc
ctgactgatttgattaactctcagtcaacaggattccctgttaaaaaagccctgggttat
atgcagcaggttttagatgctcttcttgtaactgaacaaaaaggtattagtcattgcgat
ttaaagcctgaaaatattttagttgataatgaagaacgagtttatgttgctgactttggt
gtcgcctcagcactgagcgataccgaggaagagagtattcacggaacacccgtatatgca
agtcccgaatatttagagcttggccagataaataaaactacggatacttattctgtagga
gtgatactttatgagttaatcacgggtcatactccgttttccagttctactatcaacgat
cttctacaagaaaagaagcgtgaaacctttaatgggttaccaaaaaaagctgccggttct
gaattatcgtcattagtttcaagctgcctggcagcggagccaaaaagaagaccccaaagc
ctggcaagcctgtcggaaagaattgcgcaattagtcaacgaaacgccaaagcgcaacagg
ataagttatggctatctgagtttagcagctatattttctgtagttattattggcagtttt
tatttattacagaaagaagatacaaggctttcagtttctgccgaacaaaagcaaatggct
aagcagggcttagctatcttgccttttaaaactgaagccatgtcaaatcaactctggctt
actcagggcctaccatcagttttatctcaagagctttctcaagctcctgatctacgagta
gtcggtacagccagaaccaagcgaacaatggatctgcttgggtactctcgggatttaagc
gaccaaaagtttgttactctcagcgaactattgcagactccggtttttctcgatacttct
attattctcataggacctaataagtatcgactgaaggccgaagtagtagaagttactggt
aataatattagtagaacccagctgcttgaactccagtcctctgaacaggagttttctaag
gaactcaaacagctaacggaatccctcaatacctttttcagtttgtccaacatcaccgat
cagttgttaatgcctgagggcttatcgatacaaaaatggtctgagcttgaggtgttgata
aaggatggtaagctcgcacgcgccaagaaacagctagaaagcttaattaataattaccct
gaatttgcccaggctcactttctattaggtgaagtgttgttaaaaagtggagaggaacaa
gaggctggtgaggcatttaaaaaagttaaggagcttactgcgcccaatcaacttatccac
caaaaatctaccatagagcaattccttatagctggtgatttagagtccgcttcaactgtg
tatgaaacgattctagagcgtttacccaagagagatgatatccggtttgaattagcccag
ctatatattaatttggagcaactggataaagctgagatagagctcaagcatattgtcgag
gaagatcaaaatcatccagtcgcatggtatgagttgtcgaaggtagccatttggaaagga
cagacggaaaaagctgttgatgactacctggttaaagctctggtcacagcaaaaaaatta
aaaaatgaacagctcaggggcgatgtactgaatgcttttggtgtcgcttatcaccgtcta
ggtgagcttgatttgtctttggactattaccaacagggactggaggtcaggcagtctgta
ggtgatagcagaggtatcgttacaagtttatctaacttggcatcaatttatgcggttaag
ggacagtatgacaaagctgaacaaaatctataccaagctattgaagttaacaagcctcgc
aatgacgctttaaaacaggcagatttgtttaacgaactgggagtcatagccgaggaacaa
ggccagtataaaaaagccctggagcattttagggcatccctaagcataaggatgaagctg
gatgatgactggctaaaagctgaaagcttaaataacgtggcttatatttattttttgctg
tcagatgaagaacatgcaacgatttattgggaacaggcgaaaaattattatgaaaaggtt
aaagaccctgttggtgtcgttcgtgtgaatgaaaatgtagggcagttaagtttaagaaaa
ggtgactggcaatctgcgtttcaaatattttctcaggccaaagaaaagtctgagtcatta
agcttgttcgaagaaagagttgtggcagaagcctatttggctaaattagcgttactcaaa
gggaattttgaagctccccttgaaaagcttaaggaaatcaaggctacgcttagtgagaga
gatgatattagaggccaaatagagttcggaatctggctagccgattggaatattatttct
ggtaattattctgaggcaagtaggttgcttcagctgcttgagccgttgctaagcaaagag
cataatcgatctcagcagatgatatttcatgttttaaaatccaagttgaaactctatcaa
ggtgaaagcgtgagtctggatgaaagtgatcttccagatgctgatggtttaacctcgaaa
gcttcattaaaattgttattatttaaactggaaaaagctttgttcacgagtgatgtcagc
aaagctgagtttaatgatctagtggctgcaattgaaagttatgatttagcacttcatcag
tttgctttattagagtatctccagctaaaagcaatctactacataaaaataaacgattat
aaaaaactggaagtaagcgtgaatcagctgcgtgagttacgcaaatcacttggttctcac
tggagcgactttatttctgaacgcattataagtaactattaccaattaacctcagatgat
gttaaagcacaagagtatggccaattggctgtatcaaagtttaaagaattattagaagag
ttgcccgaagagcagcaaaaaaatctgatttcattgcatggacgttacatatttccagac
gattttatggagaaactgctatga

DBGET integrated database retrieval system