KEGG   Kangiella sediminilitoris: KS2013_1277Help
Entry
KS2013_1277       CDS       T04467                                 

Definition
(GenBank) Histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
ksd  Kangiella sediminilitoris
Pathway
ksd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KS2013_1277
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ksd01001]
    KS2013_1277
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ksd02022]
    KS2013_1277
   02035 Bacterial motility proteins [BR:ksd02035]
    KS2013_1277
Enzymes [BR:ksd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     KS2013_1277
Protein kinases [BR:ksd01001]
 Histidine kinases
  NtrC family
   KS2013_1277
Two-component system [BR:ksd02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   KS2013_1277
Bacterial motility proteins [BR:ksd02035]
 Pilus system
  Twitching motility proteins
   KS2013_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_7 Wzy_C DUF3038 PAS_4 Tma16 DUF948
Motif
Other DBs
NCBI-ProteinID: AOE49992
UniProt: A0A1B3BB19
LinkDB All DBs
Position
1402876..1404462
Genome map
AA seq 528 aa AA seqDB search
MRNNNKKIEFGWQFLRYYGATRVILCLLLLLLPYFFQAQDRLYNVDIYTTTAISYLIVAN
LLMFMAFVEHQFRIQAMFPPLLDILFIAILAYAGYQSTSVYILLMALVAIVGIFLVRHRI
GIIYGIFACAAIVFIRNYRLDGISISDFSDVSLQIAGILAVTVLANILARRLTDYEAKTI
EQSYSIEKLNELNKQIIDKMNRGVVVVDNEFKVQHINQTAWYGLGLPEDPIGKPLKTIAD
ELDYQLQTFNTLHDTSQGEVKKEGLPFRATNTGPQLLPNYISLAEGEKILITLDNYSEVL
KRVQQLKLASLGQLTANIAHEVKNPLSAVSQASQLLSESSSLSKDEKELTAIIYRQSKRI
NEIIENVQKVSKSKPPNREQFELKEFIESFTEEYRQGLTFEPQLTIEDINSSLSIQFDKC
QLKQILSNLFDNGLKYSFLKTKEYRLHVTAGQDPVSGDLFLDVIDEGPGISLEDKDKIFE
PFYTTAHDGTGLGLYISKELCEANQARLDCIPVAFGGACFRISFDNSH
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaataacaataaaaaaatagagtttggctggcagtttcttaggtattatggagct
actcgagtcatcttgtgtttgttattgctattattgccctactttttccaggctcaagac
aggctttacaatgtggatatctataccacaacggccatcagttacctcatagtagccaat
ctactgatgtttatggcctttgttgagcatcagttcagaatacaggcaatgtttccacca
ttgctggatatactgttcattgcgatactagcttacgcgggttaccagagcacttccgtc
tacatcctcctgatggctctagtcgctattgtcggtatttttctggttcgtcatcgaata
ggaatcatatatggcatttttgcatgcgctgctatcgttttcatacgtaactatcgcctc
gatggaattagcatatcggacttctcagatgtcagtctgcagattgctgggattcttgca
gttactgtactagctaacattcttgctcgacgtttaacagattatgaagcaaaaaccatt
gagcaaagttactctatagaaaagttaaacgaactgaataagcaaatcattgataagatg
aatcgtggcgtggtggttgtcgataatgaatttaaggttcagcatataaaccagacagcc
tggtatggtctaggactaccagaagaccctattggcaaacctctgaaaacaattgcagat
gaactggactaccagcttcaaacgtttaacacgttacatgatacgtcacagggcgaagtc
aaaaaagagggtttgcctttcagagctacaaatacgggtcctcaactactgccaaactac
atttctctggctgaaggcgaaaaaatattaataactttggataactattcggaagtcctg
aagcgcgttcagcaattaaagttagcgtccctgggacagttaactgcaaatatcgcccac
gaagtaaaaaaccctctaagtgccgttagccaggcttctcagctgttgtctgaaagcagt
tcattatcaaaagatgaaaaagagctaacggcaattatttacaggcaatcaaagcgtatc
aatgaaattattgaaaacgtgcagaaagtttcaaaaagtaaaccgcctaatagagagcag
tttgagttgaaagagtttattgagtcatttactgaagagtacagacagggacttaccttt
gagccacaattgacaatagaagacataaactcctctttaagtattcaatttgataaatgt
cagctaaagcagatactttcaaacctctttgataatggtttgaagtatagttttctgaaa
acgaaagaataccgtttacatgtaacagccggtcaggacccagtaagcggtgacttattt
cttgacgtgattgatgagggtccgggaataagccttgaggataaagataaaatttttgaa
ccattttacaccacagcccatgatggtacagggttgggcctgtatatttcaaaagagctg
tgtgaagctaaccaagccagattggattgtattccagtagctttcggaggtgcatgcttc
cgaatcagtttcgataactcccattaa

DBGET integrated database retrieval system