KEGG   Kangiella sediminilitoris: KS2013_2040Help
Entry
KS2013_2040       CDS       T04467                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
ksd  Kangiella sediminilitoris
Pathway
ksd00380  Tryptophan metabolism
ksd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    KS2013_2040
Enzymes [BR:ksd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     KS2013_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP FlbD
Motif
Other DBs
NCBI-ProteinID: AOE50745
UniProt: A0A1B3BD90
LinkDB All DBs
Position
2196100..2197389
Genome map
AA seq 429 aa AA seqDB search
MSTIFSLDHAKDLDNQDPLREIREEFSIPKQSNGEDEIYLCGNSLGLQPRLAAQYVNDEL
GQWRALGVKGHFSGDYPWMPYHEFLSQGFADLVGAKTTEVVSMNTLTANLHFMMVSFYRP
TNQRHKIIIEDHAFPSDHYAVESQIKYHGHDPKESMILLKPRDGEETLRDEDIIQAIEEH
GDTTSLILLPGVQYYTGQVLDMESITKAGHAKGCYVGFDLAHAAGNIPMELHQWGPDFAA
WCTYKYLNSGPGSVAGCFVHERHHKNKELPRFAGWWGHDKESRFKMENSFVPTESAEAWQ
LSNPPILSLASIRGSLDTVAKAGGIHKLREKSLKLTAYLRQLLESELADEVNILTPKSEK
ASGAQLSLTINLHGTDGKTIFDAIEAAGVTCDFRYPNVIRVAPVPQYNSFEDCYRFVVIL
KQAIEGAAS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaatttttagtttagaccacgcaaaggatctggataaccaagatccccttaga
gaaattcgtgaagaattttctataccaaaacaaagcaatggcgaagatgaaatttacctg
tgcggcaactctcttggattacagcctcgccttgccgcacagtatgtgaatgatgagtta
ggtcagtggcgggctctgggtgttaaaggccatttttccggtgattacccatggatgcct
tatcatgagtttttaagtcaggggtttgctgatctggttggtgccaaaaccaccgaagtc
gtgagtatgaatacactaacagcaaacctacactttatgatggtcagcttttatcgcccg
actaaccaacgtcataaaattattatcgaagaccatgcattcccttctgatcattatgct
gttgagtctcaaatcaagtaccacggccatgatccgaaagagagcatgattttattaaag
cctcgtgatggcgaggagactctgcgcgatgaagatataattcaggctatcgaggagcac
ggtgacaccacctctttaatcttattgccgggagttcagtactataccggtcaggttctg
gatatggagtcgattactaaggccggccacgccaaaggttgttatgttggtttcgatctg
gctcatgctgcgggtaatattccgatggaactgcatcaatggggaccagatttcgctgca
tggtgtacttataaatacttaaactcaggccccggttctgttgcgggctgctttgtccac
gaacgtcaccacaagaacaaagagcttcctcggtttgctggctggtggggacatgacaaa
gagtcgcgctttaaaatggaaaacagttttgttccaacggaaagtgccgaagcatggcaa
ttatccaacccgccgattctatccctggcctcaatacgcggttctctggatactgtggca
aaagctggtggcatccataagctacgcgaaaaatctctgaagctgacagcctatcttcgt
cagttattggaaagcgaactggctgatgaagtgaacattctgacaccgaaatcagaaaaa
gcatctggtgcgcaactttcgcttacgattaacttgcacggaaccgacggcaaaacaatt
tttgatgcgattgaagcggcaggtgttacctgtgacttccgatatcctaacgtgattcgg
gttgcaccagttccgcagtacaactcattcgaagactgttatcgttttgtggttatcctc
aaacaagctatcgagggagcagcatcatga

DBGET integrated database retrieval system