KEGG   Kangiella sediminilitoris: KS2013_2044Help
Entry
KS2013_2044       CDS       T04467                                 

Definition
(GenBank) Penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ksd  Kangiella sediminilitoris
Pathway
ksd00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KS2013_2044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ksd01003]
    KS2013_2044
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ksd01011]
    KS2013_2044
Enzymes [BR:ksd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     KS2013_2044
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KS2013_2044
Glycosyltransferases [BR:ksd01003]
 Polysaccharide
  Bacterial polysaccharide
   KS2013_2044
Peptidoglycan biosynthesis and degradation proteins [BR:ksd01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   KS2013_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AOE50749
UniProt: A0A1B3BD50
LinkDB All DBs
Position
complement(2200225..2202537)
Genome map
AA seq 770 aa AA seqDB search
MSKKTRKKTSNKKNEAKLARRKKLRSLFWKLALIFIVVFAGFTIYLDSIIQSKFKENRWE
LPARVYAQSLDLANGKPMTPTRLRQELELLGYRKVVKATRQGDYENYQNSFFIYIREFQF
WDSTQPALPVSFNIKSGRIKDLKNRDTGESLQMARLDPLLIGQFHPNRLEDRILVHLDRV
PDHLKQALLAVEDRDFYEHSGVSVKAVARALWHNVTSDGRAQGGSTITQQLVKNYFLTNE
RTLWRKFKEAIMSVILEVRYEKEDILQAYFNEVYFGQDGGRAIHGVGLASQYFFDKRARD
LTPAQSALLVGMLKSPTGYNPRRNKEASLQRRNQVLKIMYQQKILTEQEYKQQRQTTLSV
VSKPSLKLSRVPAFMDLVRRQLQKSYSEEELRSEGLRIFTTLDPVMQRYTEEKVQTTLER
IELMKGIEEDSLQTAVIITSSETGNILALVGDRYSDKAGFNRAIDAKRQIGSVIKPYVVL
AALEKTDDYNLATIVSDEELSIKQRDGTLWVPRNYDRRFHGEVPLFVALMESYNIAMARL
GQLVGIDTVAEFIEQAGVEEEVRALDALPLGVLELTPIELAGLYQSLASGGLKIKPSAIT
AVTDNEGSLLERYPIESERIASELNTYLVKAGMQLVVEKGTARYLHQQNPFTNFAGKTGT
TNDLKDSWFAGFSGEHLAVVWVGRDDNKEANITGSSAALPVFTDIFNGVPTESLRLGYYD
EIEWKLIDPESGLIAGDGCIEAIEIPFIRGTAPEDVVDCNADEEEGFLEF
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaagactcgaaagaaaaccagtaataaaaagaatgaagcgaaactggcgcgt
cgaaagaagttacgttcattattttggaagttggccttaatttttatagttgtatttgcc
ggctttacgatttatctcgattctatcatccagagtaaatttaaagagaatcgttgggag
ttacccgctcgagtgtatgctcagtctcttgatctggcgaacggtaagccgatgacaccg
acacgcttacgccaggaactggagttgctgggctatcgtaaagtcgttaaggctactcgg
cagggtgattatgagaactatcagaattcttttttcatctatatccgtgagttccagttc
tgggatagtacacagccagcgctaccggtctctttcaatattaagtcgggacgtatcaag
gacctcaaaaatcgagataccggtgagtccctgcagatggctcgactcgatccgttgcta
ataggtcagtttcaccccaatcgtttagaggacagaattctggtgcaccttgatcgcgtt
cctgatcatttgaaacaggcgttactggcagttgaggacagagatttctatgagcacagt
ggggtgtcagtaaaagccgtggcgagagctctgtggcacaacgtgactagtgatggccga
gcccagggcggaagcaccattactcaacagctggttaaaaactactttttaaccaatgag
cggactctatggcgaaaatttaaggaagccataatgtccgttatcttagaagttcgctat
gaaaaagaggacatcctacaggcctattttaacgaggtatattttgggcaagatggtggt
cgtgctattcatggtgttgggttagccagccagtatttctttgacaaacgagcgagagat
ctgactccagcacaatcggcattattggtcggaatgttaaagagcccaaccggttataac
ccaagaagaaataaagaagcatcgctgcagcgtcgaaatcaggtactgaaaataatgtac
caacagaaaattttgactgagcaagaatataaacagcagcgccagacgactttgtcggtg
gtttccaaaccctcactgaagttatctagagtccctgcattcatggatctggtacgtcga
cagttgcagaagtcttattcggaagaagagctgagatcggaaggtttgagaatttttact
acacttgatccggtgatgcagcgttataccgaagaaaaagtacagacaacattggagcgt
atcgagctgatgaaagggatcgaagaagattccctacagactgctgtaatcattacttca
agtgaaacaggtaatattctggccctggttggcgatcgttattccgataaggcgggcttt
aaccgtgctattgatgcgaaacgtcagattggttctgtgattaagccatatgtcgtattg
gctgccctggaaaaaacagatgattataatctggcgaccattgtgagtgatgaggagtta
tcaattaagcagcgtgacggtaccttatgggttcctaggaattatgaccgccgctttcac
ggtgaagtaccgctgtttgtagccctcatggagtcctacaatattgccatggctcgtttg
ggccagctggtaggcatcgatacggtagcggagtttattgagcaggcgggtgtagaagaa
gaagttcgagccctggatgcattacctttgggtgtgttagaactgactcctatagaactt
gcgggtctataccagtctctggccagcggtggcctgaagattaagccttctgcgattacc
gcagtgactgataatgaaggaagtttactcgagcgctatccaattgagtctgagcgtatt
gcctctgaattaaatacctatctggtgaaagctggtatgcagctagtcgttgagaaagga
accgcccgttaccttcatcaacaaaacccgtttacgaactttgcgggtaaaacgggaacc
accaatgaccttaaggactcctggttcgcgggtttctcaggtgagcatttggcagtagtc
tgggttggccgtgatgataacaaagaagcaaatataaccggctcttcagcagcactacct
gtgtttaccgacatttttaatggcgtgccaacagagtctttaaggctgggatattacgac
gagatcgagtggaagctgattgatccagagtcgggcttaattgctggtgatggctgcatt
gaagctatcgagattccatttatccgaggcacagcgccggaggatgtcgtggattgtaat
gcggatgaagaggaggggttccttgagttttaa

DBGET integrated database retrieval system