KEGG   Kangiella sediminilitoris: KS2013_2074Help
Entry
KS2013_2074       CDS       T04467                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ksd  Kangiella sediminilitoris
Pathway
ksd00550  Peptidoglycan biosynthesis
ksd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KS2013_2074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ksd01002]
    KS2013_2074
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ksd01011]
    KS2013_2074
Enzymes [BR:ksd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KS2013_2074
Peptidases [BR:ksd01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   KS2013_2074
Peptidoglycan biosynthesis and degradation proteins [BR:ksd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   KS2013_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 DUF1381 GxGYxYP_C CytoC_RC
Motif
Other DBs
NCBI-ProteinID: AOE50779
UniProt: A0A1B3BD77
LinkDB All DBs
Position
complement(2227270..2228454)
Genome map
AA seq 394 aa AA seqDB search
MNSVEIMMKRIFSIEVLIFSLVLLMVASNAQAIQPGKPSVDASSWLIMDYETGQILMEEN
SRQKLPPASLTKMMTSYIIADQLHKGNISEDDKVLISENAWAQNPKLKGSSLMFVEVNKY
VSVEDLHRGIVIQSGNDASIAMAEHIAGSEDAFADLMNQYAKRLGMSDTHFMNSTGLPHE
QHMTTARDLAKLARALIADFPEDYAMYSEREFTYNNITQKNRNELLGDTTLGVDGIKTGH
TEDAGFCLVSSAEKKGMRLISVVMGTDSMSARASESRKLLNFGFRFYTNINAFAAGKPLK
QAEVWKGEKEQVGVGLAQDAVLSVLKTEKDQLKANYTMSGKLIAPIQKGQVVGEVTFSIG
DKVVKRLPMVALDNVEEAGFFGRMWDSIALWFND
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgttgaaatcatgatgaaacgaattttttccattgaagtactgatttttagt
ttggttttgttgatggtagccagcaatgcgcaggctatacagccagggaagccgagtgtt
gacgccagctcatggttaataatggactatgaaaccgggcagattttgatggaggaaaac
tccagacaaaagttgcctccagcgagtctgaccaagatgatgaccagctatatcattgct
gaccagttacacaaaggtaacatcagtgaggatgataaagtcttaatcagcgaaaacgcc
tgggcacagaaccctaagctgaaaggtagctccttgatgtttgttgaggttaacaagtac
gtgtcagtggaggacttacaccgtggaatcgtgattcagtcgggtaatgatgcaagtatt
gccatggcagagcacattgcgggtagcgaagatgcttttgctgatctaatgaatcagtat
gccaagcgactgggaatgagtgatactcatttcatgaatagtacaggccttccacatgag
cagcatatgaccactgcccgtgacttggctaagctggcaagagccttaatagcagacttc
cctgaagactatgcgatgtactcagagcgtgaatttacctacaacaacattactcagaaa
aatagaaatgagttgttaggagatactactttgggtgtggatggaattaaaacaggccat
acagaagacgctggtttttgtctggtgtcttctgccgaaaagaaaggaatgcgtcttatc
tctgtagttatgggtaccgacagcatgagtgctcgtgccagtgaaagccgcaaattgttg
aacttcggtttccgcttctacaccaatattaatgcatttgccgcaggaaagccgcttaaa
caggctgaggtatggaagggcgaaaaagagcaggttggagtaggcttggcgcaggacgca
gtgctatccgttcttaaaacagagaaagatcagttaaaagcaaactataccatgagtggt
aagctgatcgccccgatccaaaaaggtcaggtagttggcgaagtcaccttcagtattggc
gacaaggtagttaaacgcttacctatggtagcattggataatgtagaagaagcaggtttc
tttggccgtatgtgggactctattgccctttggtttaatgactaa

DBGET integrated database retrieval system