KEGG   Kangiella sediminilitoris: KS2013_313Help
Entry
KS2013_313        CDS       T04467                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ksd  Kangiella sediminilitoris
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KS2013_313
Enzymes [BR:ksd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     KS2013_313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO Thi4 FAD_oxidored NAD_binding_8 Lycopene_cycl NAD_binding_7 AlaDh_PNT_C K_oxygenase Glutaredoxin FAD_binding_3 Thioredoxin_9 ABC_transp_aux Thioredoxin_4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOE49039
UniProt: A0A1B3B8A7
LinkDB All DBs
Position
complement(312771..314387)
Genome map
AA seq 538 aa AA seqDB search
MLNNQILEALKGYTADMQKTVTFVLQTGEHSKRNELIEFLKGFASVSNKVQFEERDLNGK
VRSPISFLLEVDGQDTGLQFSGIPSGHEFNSLVLAVLQSAGTPIKLDSSLQNMVKNVDHE
MKFEVFVSLSCHNCPDVVQALNQFAVLNPNISAEMIDGGLFQDVIEERDIQGVPSVYLNG
ELFANGKITAAELIDKLLEKDPSIAKADSNEKLPLQDVVVIGGGPAGVSSAIYSARKGLK
VTLIADRIGGQVKDTMGIENLISVPKTTGPELVGALQTHMDEYDITIKEHLRVTEVNQGD
IKSIALSSGEVIDTKTVIIATGAKWRELGIPGEKENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADQVLVDQAEGKDNITILKNVATQEIHADG
GKVSSISYQDRATETTHSIDLDGVFVQIGLVPNTSFLGDVVETTKFGEIVINEKCETSQP
GIYAAGDVTTVPYKQIVVSMGEGSKASLASFEYLLANSSKLENMYEDHQSSQQARDAA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaatcaaatcttagaagctttgaaaggctataccgcagatatgcaaaagacg
gtgactttcgtcttgcaaaccggtgaacattcaaagcgcaacgaattaatagaattctta
aaaggctttgccagcgtcagcaataaagttcaatttgaagaacgcgaccttaacggcaaa
gtacgtagtccgatcagcttcctgctagaagttgatgggcaagatacaggccttcagttt
tcgggcatcccttcaggccatgaatttaactcattggtgctggctgtacttcaatcagcg
ggaacccccattaaactggacagctcactgcaaaacatggtcaagaacgttgatcacgaa
atgaagtttgaggtgtttgtcagccttagctgtcacaactgccctgatgtcgtacaggcc
ctgaaccaatttgccgtgctcaatccaaacatttcagctgagatgatcgatggcggcctg
ttccaagacgttattgaagagcgtgatattcaaggtgtaccaagtgtttatctgaatggc
gaactattcgctaacggtaaaatcaccgcagcagagctgattgataaattactggagaaa
gatccgtccatcgcaaaagctgactctaatgaaaagcttccactacaggacgtagtagtc
attggtggtggcccagccggcgttagcagtgcaatttatagtgcacgaaaaggcttaaaa
gtgaccttgattgccgaccgtattggtggtcaggttaaagacaccatgggcatcgaaaac
ttaatttctgttcctaaaacaacagggccagaattagtcggcgcgctgcagacacatatg
gatgaatatgacatcaccattaaagaacatctgcgagtgacggaagtaaaccaaggtgac
attaaaagcatcgcactatcatcaggcgaagtcattgacaccaagacagtgatcattgct
acgggtgccaaatggagagaactaggcattcctggtgagaaagaaaatgttggtaatggt
gttgcctactgtccgcactgtgacggtccattctttaaaggaaaagacgtagcagtaatc
ggtggcggtaactcgggtatcgaagcggcactggacttggcgggtattgtaaaatcggta
acggtttttgaatttatgcctgagctgaaggctgaccaagtgttagtcgaccaggcagaa
ggcaaagacaatatcaccattttgaaaaatgtagccactcaggaaattcacgctgacgga
ggaaaggtttcatcgatttcttatcaggatcgtgcgactgaaactacccacagcatcgac
cttgacggtgtatttgtacaaattggattagtaccgaacaccagcttcctgggtgatgtg
gtcgaaaccacgaagttcggcgaaatcgtgattaacgaaaagtgcgaaacttcacagccg
ggaatctatgccgccggtgacgttacgacagtaccgtataaacaaattgtggtgtccatg
ggcgaaggctctaaagcttcacttgcctctttcgaatacttactggctaactccagtaaa
ctcgaaaacatgtacgaagaccatcagtcttcacagcaagcaagagacgctgcataa

DBGET integrated database retrieval system