KEGG   Kangiella sediminilitoris: KS2013_544Help
Entry
KS2013_544        CDS       T04467                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ksd  Kangiella sediminilitoris
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ksd01001]
    KS2013_544
Enzymes [BR:ksd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KS2013_544
Protein kinases [BR:ksd01001]
 Serine/threonine kinases: Other
  Bacterial family
   KS2013_544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like HAMP Kdo EzrA DUF3566 CCB1 Pox_ser-thr_kin DsbD_2
Motif
Other DBs
NCBI-ProteinID: AOE49268
UniProt: A0A1B3B8Z1
LinkDB All DBs
Position
567640..569343
Genome map
AA seq 567 aa AA seqDB search
MSNKLTIGRYELIEEIGRGAMSVVYLAKDPDIGRSLAIKLLKHDLVEKEEYRKLFLREAR
AAGGLSHPGIVTIYDVGIWQDRPYIAMELLEGKNLDDYLSEEGAMPLEDALEMAQQLTVA
LHYAHKKGVVHRDIKPENILVLDEGRRFKITDFGIARIEHQYMEGESEEEQAKVMGTPAY
MSPEQISGKGTDFKTDLYSIGVILYKVTKGELPFEAANYGAMMQAVLQQNPQPLNAYSEQ
GFIWQSIIFRLLQKNPDLRYHDTDELIKELDALSKEIEQSGQGVGSIRFFSMRARWAIAL
STLVLVVMVLGMFWVYERQNSLMNQLVYDYGSSMAQIISSETAEPLLLDENVALQAITVD
IVENSDVLYLSIRDSNGLVQSSSMEQQVGKQHQLFEGSESLGGMKGSRIFQNADTFKQET
FLFDTPISFQDKKIGFATIAIGREKLTSATRSSLLTMIIWMFVIMLAVFSGVYWLANKFT
QRINKVRQAVKDIKTHGQADLISIDSHDEVGRLQQELNNLNQKLAGITKTQHMSVDEVNA
SIKEMTEMDKTVLLDYSEPGKNDSEKP
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataagttaaccatagggcgctatgagctgattgaggaaatcggccgtggcgcc
atgtctgttgtttatttagcaaaggatcccgatatcggtcggtcacttgcgattaagctg
ttaaaacatgacctggttgagaaagaggaatatcgcaagctatttttgcgtgaagcccga
gcagcaggtggtttgagtcaccccggaattgtaactatttacgatgttggcatctggcaa
gatagaccctatatcgctatggagttgctggaagggaagaacttggacgattacctgtct
gaagaaggtgcaatgcctttggaagatgctctagaaatggcccagcaattgacagtagcc
ctacattacgcccataaaaaaggggtcgttcaccgcgacataaagcctgaaaatatcttg
gttctcgacgagggtagacgcttcaagattaccgattttggtatcgctcgaattgagcat
caatatatggagggtgagagcgaagaagagcaggccaaggtcatgggtactcctgcttac
atgtcacctgaacagatttctggtaaaggtactgactttaaaacggatctctactcgatc
ggcgttattttatacaaagtaacgaaaggagagttaccttttgaggccgccaactacggg
gccatgatgcaagctgttttgcagcagaatccacagcctttgaatgcatactctgaacag
ggctttatttggcagagtattattttcagattgctccagaagaatccggatcttcggtat
catgatactgatgagctgattaaagagcttgatgcgctgtcaaaagaaattgagcaaagc
gggcagggtgtagggagcattcgctttttctcaatgcgtgcacgatgggcgatcgcgttg
tctactctggtattggttgtcatggtattggggatgttttgggtttatgagcgacagaat
tcgttaatgaaccagctagtgtatgattatggaagctcaatggctcagattatctcaagt
gaaactgcggagcccttgctgcttgatgagaatgtagcgttacaggcaattactgtagac
atagtagagaactcagatgtcctctatctatctatcagggatagcaatgggttggtacag
agcagtagtatggagcagcaggtcggtaagcagcaccagctttttgaaggtagtgagtct
ctcggtggcatgaaaggaagtcgaatttttcaaaatgcagacaccttcaaacaggaaaca
tttttgttcgatacacccatttcattccaagataagaaaattgggtttgcaacaatcgca
ataggccgagaaaaactaactagcgcgacacgttcttcattgctgacaatgattatctgg
atgtttgttattatgctggcagttttttcaggcgtgtactggcttgctaataaatttact
cagcgaataaacaaagtgcgacaggcagttaaagatattaaaacgcatggccaggcagac
ttaatttccattgattctcatgatgaggtcgggcgcctccagcaagaattgaataatctt
aatcaaaagttggcaggcataacaaagacgcaacatatgagtgtcgatgaagtaaatgct
tcaattaaggaaatgacagaaatggataaaacggtattactggattactcagagcctgga
aaaaatgactctgagaaaccttag

DBGET integrated database retrieval system