KEGG   Kytococcus sedentarius: Ksed_03190Help
Entry
Ksed_03190        CDS       T00974                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kse  Kytococcus sedentarius
Brite
KEGG Orthology (KO) [BR:kse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ksed_03190
Enzymes [BR:kse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Ksed_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like Glutaredoxin FAD_binding_2 AlaDh_PNT_C FAD_binding_3 K_oxygenase DAO Thioredoxin_4 Thi4 FMO-like TraF NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACV05396
UniProt: C7NK09
LinkDB All DBs
Position
305750..307432
Genome map
AA seq 560 aa AA seqDB search
MLDQNLATQLRQLLGNLKRPIELLTTVEADATDATSRETLELCAEIAEMSELVTTREAEG
EERADRAPSFRIQAAADTSSAVTFAGLPMGHEFTSLVLALLNIGGHPSKAAAETIEQIRG
IEGTHRFETFFSQSCQNCPDVVQALDLMATLNPNITHVAIDGSAFPEEADERGVMAVPTV
FLDGEDFGSGRMTLEEIVERIDTGAAEAAADRLADADPYEVLVLGGGPAGSTAAIYAARK
GIRTGLVAERMGGQVNDTMSIENVSGTSHTEGPKLAADLERHVNDYEVELVKSQEAVGVT
PAEAEGGYHSVELASGATLRSRSLVIATGASWRTMGVPGEDEYRNKGVTFCPHCDGPLFK
GKRVAVIGGGNSGVEAAIDLAGIVGHVTVLEFMDSMRADQVLQDKLRSLPNVDIVLGAAT
KEVVGDGSRVTGLKYEERATGESHQLELEGVFVQIGLVPNSAFLKESGVELTDRGEVVID
GRGATNVPGIFAAGDVSTVPYKQIVVAFGSGSTASLSAFDHLIRTSAPADEPASETAAAT
KVVDSENEPTDVADLADANS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgaccagaacctcgccacccaactccgtcagctcctgggcaacctgaagcgcccc
atcgagctgctcaccaccgtcgaggccgatgccaccgacgccacctcgcgcgagacgctg
gagctgtgcgccgagatcgccgagatgtccgagctcgtcaccacccgcgaggccgagggt
gaggagcgcgccgaccgggcgccttccttccgcatccaggccgcggccgacacctcctcc
gcggtgaccttcgccggtctgccgatggggcacgagttcacctccctggtgctggcgctg
ctgaacatcggtggccaccccagcaaggccgccgccgagacgatcgagcagatccgcggc
atcgagggcacccaccgcttcgagaccttcttcagccagtcctgccagaactgccccgac
gtggtgcaggcgctggacctcatggcgacgctgaacccgaacatcacgcacgtcgccatc
gacggctcggccttccccgaggaggcggacgagcgcggcgtgatggccgtgcccaccgtc
ttcctggacggcgaggacttcggctccgggcgcatgaccctggaggagatcgtcgagcgc
atcgacaccggcgccgccgaggccgccgcggaccggctggccgacgccgacccctacgag
gtgctggtcctgggtggtggccccgccggctccaccgccgcgatctacgccgcgcgcaag
ggcatccgcaccggcttggtggccgagcgcatgggtggccaggtcaacgacaccatgagc
atcgagaacgtctccggcacctcgcacaccgagggcccgaagctggccgccgacctcgag
cgccacgtgaatgactacgaggtcgagctggtgaagtcccaggaggccgtgggcgtgacc
ccggccgaggccgagggtggctaccactccgtcgagctcgcctccggtgccacgctgcgc
tcccgctcgctggtgatcgccaccggtgcctcctggcgcaccatgggcgtccccggcgag
gacgagtaccgcaacaagggcgtcaccttctgcccgcactgcgacggcccgctgttcaag
ggcaagcgcgtcgccgtcatcggcggtggcaactccggtgtggaggccgccatcgacctg
gccgggatcgtcggccacgtgacggtgctggagttcatggactccatgcgcgccgaccag
gtgctccaggacaagctgcgcagcctgccgaacgtggacatcgtgctgggcgccgcgacg
aaggaggtcgtcggcgacggctcccgcgtgaccgggctgaagtatgaggagcgcgccacg
ggcgagagccaccagctggagctcgagggcgtgttcgtgcagatcggtctggtgcccaac
tccgccttcctgaaggagtccggcgtcgagctcaccgaccgcggcgaggtcgtcatcgac
ggccggggtgccacgaacgtcccgggcatcttcgccgccggcgacgtctcgaccgtgccg
tacaagcagatcgtggtggccttcgggtccggttccacggcttcactgagcgccttcgac
cacctcattcgcacctccgccccggcggacgagccggcctctgagaccgctgcggccacc
aaggtcgtggacagcgagaacgagccgacggacgtggccgacctggcggacgcgaactcg
tga

DBGET integrated database retrieval system