KEGG   Kytococcus sedentarius: Ksed_03670Help
Entry
Ksed_03670        CDS       T00974                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kse  Kytococcus sedentarius
Pathway
kse00010  Glycolysis / Gluconeogenesis
kse00260  Glycine, serine and threonine metabolism
kse00680  Methane metabolism
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
kse01200  Carbon metabolism
kse01230  Biosynthesis of amino acids
Module
kse_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_03670
  09102 Energy metabolism
   00680 Methane metabolism
    Ksed_03670
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ksed_03670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kse04131]
    Ksed_03670
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kse04147]
    Ksed_03670
Enzymes [BR:kse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ksed_03670
Membrane trafficking [BR:kse04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Ksed_03670
Exosome [BR:kse04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ksed_03670
  Exosomal proteins of melanoma cells
   Ksed_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACV05443
UniProt: C7NK56
LinkDB All DBs
Position
352673..353428
Genome map
AA seq 251 aa AA seqDB search
MTNAAHTLVLLRHGQSLWNEKNLFTGWVDVDLTEKGRAEARRGGELLVAEGYLPDVLHTS
RLRRAITTANLALDAADRHWIDVKRSWRLNERHYGALQGKDKAQVKDKYGEEQFMAWRRG
YDTPPPPIEADDEYSQAGDPRYADLGAEVPATECLKDVVERLRPYWAEEIVPDLQAGRTV
LVTAHGNSLRALVKELDGISDADIAELNIPTGIPLVYELDGNFRPLTPGGRYLDPEAAAG
AIQEVANQGSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgctgctcacacccttgtcctgctgcgccacggccagagcctgtggaacgag
aagaacctcttcaccgggtgggtcgacgtcgacctcaccgagaaggggcgcgccgaggcc
cgccgcggtggtgagctgctggtggccgagggctacctgccggacgtgctgcacacctcc
cgcctgcggcgcgcgatcacgacggccaacctggccctcgatgccgccgaccgccactgg
atcgacgtgaagcgctcctggcgcctcaacgagcgccactacggcgcactgcagggcaag
gacaaggcacaggtcaaggacaagtacggcgaggagcagttcatggcctggcgccgcggc
tacgacaccccgccgccccccatcgaggccgacgacgagtactcgcaggcgggtgatcct
cgctacgccgacctgggcgccgaggtgccggccaccgagtgcctcaaggacgtcgtggag
cggctgcgtccctactgggccgaggagatcgtgcccgacctgcaggccggcaggacggtg
ctggtcaccgcccacggcaacagcctgcgcgccctggtcaaggagctcgacggcatcagc
gacgccgacatcgccgagctgaacatccccaccggcatcccgctggtgtacgagctcgac
gggaactttcgccccctgacccccggcgggcgctatctcgaccccgaggccgccgccggc
gccatccaggaggtcgcgaaccagggcagcaagtga

DBGET integrated database retrieval system