KEGG   Kytococcus sedentarius: Ksed_18510Help
Entry
Ksed_18510        CDS       T00974                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
kse  Kytococcus sedentarius
Brite
KEGG Orthology (KO) [BR:kse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ksed_18510
Enzymes [BR:kse01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ksed_18510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ACV06853
UniProt: C7NJS1
LinkDB All DBs
Position
1928167..1928586
Genome map
AA seq 139 aa AA seqDB search
MFSGISRMLAPTLEVSAHCDLPCGVYDPAQARIEAESIKGIIEKVEGEKAGDADFRTRAI
IIKEQRAELVKHHLWVLWTDYFKPPHFEKYPQLHTLVNEATKLAGASGTKGALDLDKANE
LLAKIDEIAEIFWETKKAA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgttctccggaatctcccgcatgctcgcccccaccctcgaggtgagcgcccactgcgac
ctcccctgtggtgtgtacgaccccgcccaggcccgcatcgaggccgagtccatcaagggc
atcatcgagaaggtggagggtgagaaggccggcgacgccgacttccgcacccgcgccatc
atcatcaaggagcagcgcgccgagctcgtgaagcaccacctgtgggtgctgtggaccgac
tacttcaagcccccgcacttcgagaagtacccgcagctgcacaccctggtgaacgaggcc
accaagttggccggtgcctcgggcaccaagggcgcactggacctggacaaggccaacgag
ctgctggccaagatcgacgagatcgccgagatcttctgggagaccaagaaggcggcctga

DBGET integrated database retrieval system