KEGG   Kytococcus sedentarius: Ksed_19790Help
Entry
Ksed_19790        CDS       T00974                                 

Definition
(GenBank) DNA ligase D/DNA polymerase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
kse03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Ksed_19790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kse03400]
    Ksed_19790
Enzymes [BR:kse01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Ksed_19790
DNA repair and recombination proteins [BR:kse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Ksed_19790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ACV06977
UniProt: C7NKD9
LinkDB All DBs
Position
complement(2062906..2065542)
Genome map
AA seq 878 aa AA seqDB search
MARSERRTVRVGERTLSVSSLDKVLYPEAGTTKADVVHYYLSVAEVLLPQLAGRPVTRKR
WVDGVGTEGDPGEVFFRKDLEDSAPDWIPTGRIVHANRANSYPLATEAAVLAWFAQVAAL
ELHTPQWRFGPDGQPRRPDRLVLDLDPGEGVGLTECAQVARWCREVLDGMALEAFPVTSG
SKGIHLYAALDGTHDAEAVSAVAHELARALEADHPDLVVSTMKRARRAGKVFLDWSQNNA
SKTTVAPYSLRGRARPTVAAPRTWEELDDPGLAQLELDEVLDRVADGIDPVASLGAGTGP
GGAGEVSSPAPDRLRTYRSMRDPDRTAEPVPADPPREREAPDGELPSFVIQEHHASSLHW
DFRLEHSGVLVSWAVPKGPPLEHDTNRLAVMTEDHPLEYGTFEGTIAAGEYGAGEVTIWD
AGTYERKKWREGKEVIAVLHGRPDGGLGGVPRRFALIQATGMGSERNWLLRLTDEQPGAG
HPQDGSPEEVTAAPSPSRSRADRSDSRTARRALRRRPAPGFTVADLPAAMAATAGTPEQV
ERAVAGGQEWAFEMKWDGYRVVAGVRTAGQGPADADADADAGAEREGAVVLASRNGKDLT
DTFPAAVELTRLLRGEAAERGGAVLDGELVALDDRGRPDFGLLQAALGDGPGVNAAGDPI
ELRYLVFDLLQLGAPGDPEDRQRSLLRIPWGERRELLREVLGTGGDAVSVPPAHTGTLAQ
AQRASRGLGLEGVVAKRVDAVYLPGQRGSAWVKLKTQRHQEVVVIGVRQGRGGRSGGIGS
LLVAVGDDEGELRYAGRVGTGFSAAQLADIEKTLRRIERKTPPVDDVPAADRTDAWWVTP
RLVGEVSLAGRTRDQRVRQAVWRGWRPDKEAGEVRWEV
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcagcgagcgcaggaccgtccgcgtgggcgagcgcaccctctcggtctccagc
ctggacaaggtgctctaccccgaggcgggcaccaccaaggccgacgtcgtgcactactac
ctgtcggtggccgaggtcctgctgccgcagctggcgggccgtccggtgacgcgcaagcgc
tgggtcgacggggtaggcacggagggcgacccgggggaggtgttcttccgcaaggacctg
gaggactcggcgccggactggatccccaccgggcggatcgtgcacgccaaccgggcgaac
tcctacccgctggccaccgaggcggcggtgttggcctggttcgcccaggtggcggcactg
gagctgcacaccccgcagtggcgcttcgggcccgacgggcagccccgccgccccgaccgg
ctggtgctggacctcgaccccggcgagggggtggggctgaccgagtgcgcccaggtggcg
cggtggtgccgcgaggtgctcgacggcatggcgctggaggccttccccgtgacctcgggg
tcgaagggcatccacctgtacgccgcgctcgacgggacgcacgatgccgaggcggtctcg
gcggtcgcccacgagctcgcgcgggccttggaggccgaccacccggacctcgtcgtctcc
accatgaagcgtgcccgccgggccgggaaggtgttcctggactggagccagaacaacgcc
tccaagaccaccgtggctccgtactcgttgcgcggccgcgcccggccgacggtggccgcc
ccccgtacgtgggaggagctcgacgacccgggcctcgcgcagctcgagctcgatgaggtg
ctcgaccgggtcgcggacggcatcgaccccgtcgcgagcctgggggcgggcacggggccc
gggggtgctggcgaggtgtcgtcgccggcgcccgaccggctgaggacctaccgctcgatg
cgggaccccgaccggaccgccgagccggtgccggccgacccgccgcgggagcgcgaggcg
ccggacggggagctgccgagcttcgtgatccaggagcaccacgccagcagcctgcactgg
gacttccggctggagcactccggcgtgctggtctcctgggccgtgcccaaggggccgccg
ctggagcacgacaccaaccggctggcggtcatgaccgaggaccacccgctggagtacggc
acgttcgagggcaccatcgccgcgggggagtacggcgccggcgaggtgaccatctgggac
gcgggcacctacgagcgcaagaagtggcgggagggcaaggaggtgatcgccgtcctgcac
ggccgccccgatggggggctcggcggggtgccacgccggttcgccctcatccaggccacc
ggcatgggcagcgagcgcaactggctgctgcgcctcaccgacgagcagcccggggcgggg
catccccaagacggttcccccgaggaggtgacggcggcaccgtcaccgagccggtcccgt
gctgaccggtcggactcgcgcaccgccagaagggccttgcgccggcggcccgcgccgggg
ttcaccgtggccgacctgccggcggcgatggcggccacggccgggaccccggagcaggtg
gagcgggcggtggccggcggccaggagtgggcgttcgagatgaagtgggacggctatcgc
gtggtcgcgggggtccggacggcggggcagggtcctgccgatgccgatgccgatgccgat
gccggtgccgagcgcgagggcgccgtcgtgcttgccagccgcaacggaaaggacctgacc
gacaccttccccgcggccgtcgaactcacccggctgctgcggggggaggcggccgagcgg
ggcggggccgtcctcgatggcgagctggtggcgttggacgaccggggccgccccgacttc
ggtctgctgcaggcggcgctcggcgacgggcccggcgtcaacgcggccggcgaccccatc
gagctgcgctatctcgtcttcgacctgctgcagctcggcgcgcccggggacccggaggac
cggcagcgctccctgctgcgcatcccctggggtgaacgacgcgagctcctgcgcgaggtg
ctgggtactggtggcgatgccgtgtcggtgccgccggcccacaccggcaccctcgcccag
gcgcagcgggcgagccgggggctggggctggagggggtcgtcgccaagcgggtcgatgcg
gtctatctgcccggccagcgcggttcggcgtgggtgaagctcaagacgcaacgccaccag
gaggtggtcgtcatcggggtccggcaggggcgcggcggccggtccggtggcatcgggtcg
ctgctggtggcggtgggggacgacgagggcgaactgcgctacgccggccgggtggggacg
ggcttcagcgccgcccagctggccgacatcgagaagacgctgcgccgcatcgagcgcaag
acgcccccggtggacgacgtgccggcggccgaccgcacggacgcctggtgggtgacgccg
cggctggtgggcgaggtgtccctggccgggcgcacgcgcgaccagcgggtgcggcaggcg
gtctggcgggggtggcgaccggacaaggaggccggcgaggtccgatgggaggtgtag

DBGET integrated database retrieval system