KEGG   Kitasatospora setae: KSE_15670Help
Entry
KSE_15670         CDS       T01648                                 

Gene name
glpD
Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ksk  Kitasatospora setae
Pathway
ksk00564  Glycerophospholipid metabolism
ksk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KSE_15670 (glpD)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KSE_15670 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2 GIDA FAD_binding_3 3HCDH_N AlaDh_PNT_C Thi4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: BAJ27394
NITE: KSE_15670
UniProt: E4N863
LinkDB All DBs
Position
1745481..1747085
Genome map
AA seq 534 aa AA seqDB search
MATTPPTSATVPTLGAERAAGRVASRAATRELLGRARYDLLVIGGGILGTATAWTAAQAG
LKVAMVEAGDFAGATSSASSKLVHGGLRYLQTGAVRLVAENHRERRALATHVAPHLVSPL
TFFVPVYEDGPHSAPKLGAGVFLYSALSAFRDGLGRVVSPAAAARAVPGLRTEGLRRVAV
YGDHQMNDARMAVMTVRAAVDAGAVALNHAEVTGLRFTRGRVTGAEVRDALDGTEFGVDA
RLVLNATGPWVDHLRRMEHAGAAPSIRLSKGAHVVLRRQAPWRAALTIPIDHYRVSFAIP
WEDHVLLGTTDEEYTGDPLDVRATEADVDQILAEAGHAVRGEHLRREDITYAFAGLRVLP
GGPGSTAAAKRETVVTEGRAGMLSVAGGKWTTYRHIGRVILEQLKRAPGVGLAEDVSPIP
PTVPLPGIGAPQAVARRLLTDREPGSRMDPLVARNLATHYGTLSFEIARLIAERPELGER
IHPDGPDVWAQVVYAAEQEWAYTVDDVLRRRTTLTVRGLDGAEVRKRTAELLRG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaccccgcccacctcggccaccgtcccgaccctgggcgccgagcgcgccgcc
ggccgcgtcgcctcccgcgccgccacccgcgagctgctcggccgggcccgctacgacctg
ctggtgatcggcggcgggatcctcggcaccgccaccgcgtggaccgccgcccaggccggg
ctgaaggtcgccatggtggaggccggggacttcgcgggcgcgacctcctcggcctcgtcc
aagctggtccacggcgggctgcgctacctgcagaccggcgcggtgcggctggtcgccgag
aaccaccgggagcgccgggcgctggccacccacgtggcgccgcacctggtcagtccgctg
accttcttcgtcccggtgtacgaggacgggccgcactcggcgccgaagctgggcgcgggc
gtgttcctgtactcggcgctgtcggcgttccgcgacgggctgggccgggtggtgtcgccc
gcggcggcggcccgggcggtgccggggctgcgcaccgaggggctgcggcgggtcgcggtg
tacggcgaccaccagatgaacgacgcccggatggccgtgatgacggtgcgggcggcggtg
gacgcgggcgcggtggcgctcaaccacgccgaggtgaccgggctgcgcttcacccgcggc
cgggtgaccggcgcggaggtgcgcgacgcgctggacggcaccgagttcggggtggacgcc
cggctggtgctgaacgccaccggcccgtgggtggaccacctgcggcggatggagcacgcg
ggcgcggctccgtcgatccggctgtccaagggcgcgcacgtggtgctgcggcggcaggcg
ccgtggcgggcggcgctgaccatcccgatcgaccactaccgggtgtcgttcgcgatcccg
tgggaggaccacgtcctgctgggcaccacggacgaggagtacaccggcgacccgctggac
gtccgggccaccgaggcggacgtcgaccagatcctggccgaggccgggcacgcggtgcgc
ggcgagcacctgcggcgggaggacatcacgtacgccttcgcgggcctgcgggtgctgccg
ggcgggccggggtcgacggcggcggcgaagcgggagacggtggtgaccgagggccgggcc
gggatgctgtcggtggcgggcggcaagtggaccacctaccggcacatcggccgggtgatc
ctggagcagctcaagcgggcgccgggcgtcgggctggccgaggacgtctcgccgatcccg
ccgaccgtcccgctgccgggcatcggcgccccgcaggccgtcgcccgccgcctgctgacc
gaccgcgagcccggcagccggatggacccgctggtggcccgcaacctggccacccactac
ggcacgctctccttcgagatcgcccggctgatcgccgagcgccccgaactgggcgagcgg
atccacccggacgggccggacgtgtgggcgcaggtggtgtacgcggccgagcaggagtgg
gcgtacacggtggacgacgtgctgcggcggcgcaccacgctgacggtgcgcgggctggac
ggcgcggaggtgcgcaagcgcaccgcggagctgctgcggggctga

DBGET integrated database retrieval system