KEGG   Kitasatospora setae: KSE_23300Help
Entry
KSE_23300         CDS       T01648                                 

Definition
(GenBank) putative alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ksk  Kitasatospora setae
Pathway
ksk00500  Starch and sucrose metabolism
ksk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KSE_23300
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KSE_23300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_25 CBM_20 Alpha-amylase Alpha-amylase_C CBM53
Motif
Other DBs
NCBI-ProteinID: BAJ28149
NITE: KSE_23300
UniProt: E4NAB8
LinkDB All DBs
Position
complement(2583525..2585663)
Genome map
AA seq 712 aa AA seqDB search
MPTSAPTRRRRLAAAGTALAALGLSVGAGFALAPTATATPPGGKDVTATLFEWKFDSVAK
ACTDTLGPKGYGFVEVSPAEEHVQGSQWWTSYQPVSYKIAGRLGDRASFRNMVAACHAAG
VKVIADAVVNHMSAGSGTGTGGTNYTKYTYPGYYQDQDFHSCRTSISNYGDRSNVQNCEL
VGLSDLNTGSAYVQQTIADYLSDLLTLGVDGFRIDAAKHIAASDLAAIKSKVSNPNAYWV
QEVIYGAGEAVQPGEYTGTGDVDEFRSATWLKSAFNGGRISDLQSWGSGLLGSAQARTFV
DNWDTERNGSTLTYKYGSAYTLANVFMLANPYGSPNVYSGYAFSGNDDGPPNGGTVNACY
QDGWNCTHAWRQVANMVGFRNAVAGTGLTNWWSNGNNAIGFGRGDKGYVAINRESGAITQ
TFQTSLPAGVYCDVQHGDPVNGGGCTGPTHTVGTDGRFTATVGAGDAVALYVGAGGGSAA
TPTPTPSASASASASATGTGNSATVFYSTNRNWSAYDLHYAPTGGSWTTVPGVAMDAACT
GWVKKTVALGGATGLTATFNNGNGTWDNNGGNNYPLGAGNVTVKDGAVGSGDPCATASAS
ASASASPSATAAPSVGTGASFAVNATTVVGQNIYVVGDAAELGGWDTSKALPLSAAAYPV
WKLDAALNPGTAIQYKYVRKDAAGNVTWESGANRTATVPASGKVVLNDTWRG
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
ttgcccacttccgcccccacccgcagaaggcgcctcgccgccgccggcaccgcgctcgcc
gccctcggcctctcggtcggcgccgggttcgcgctcgcgcccaccgccaccgccaccccg
ccgggcggcaaggacgtcaccgccaccctgttcgagtggaagttcgactcggtggccaag
gcgtgcaccgacaccctcggccccaagggctacggcttcgtcgaggtctccccggccgag
gagcacgtccagggcagccagtggtggacctcctaccagcccgtcagctacaagatcgcc
ggccggctcggcgaccgcgcctcgttccggaacatggtcgccgcctgccacgccgcgggc
gtcaaggtgatcgccgacgcggtggtcaaccacatgagcgcgggcagcggcaccggcacc
ggcggcaccaactacaccaagtacacctacccgggttactaccaggaccaggacttccac
tcctgccggacgtcgatcagcaactacggcgaccgctccaacgtgcagaactgcgagctg
gtcggcctctccgacctcaacaccggctccgcctacgtgcagcagaccatcgccgactac
ctgagcgacctgctgaccctgggcgtcgacggcttccggatcgacgccgccaagcacatc
gccgcgagcgacctggccgcgatcaagtccaaggtgagcaacccgaacgcctactgggtg
caggaggtcatctacggcgcgggcgaggccgtccagcccggcgagtacaccggcaccggc
gacgtcgacgagttccgctccgcgacctggctgaagagcgccttcaacggcgggaggatc
tccgacctgcagagctggggcagcggcctgctcggctccgcccaggcccgcaccttcgtc
gacaactgggacaccgagcgcaacggctccaccctcacctacaagtacggctccgcgtac
acgctggccaacgtcttcatgctggccaacccgtacggctcgccgaacgtctactccggc
tacgcgttcagcggcaacgacgacggcccgcccaacggcggcaccgtcaacgcctgctac
caggacggctggaactgcacccacgcctggcggcaggtcgccaacatggtcggcttccgc
aacgcggtcgccggcaccggcctcaccaactggtggtccaacggcaacaacgcgatcggc
ttcggccgcggcgacaagggctacgtcgcgatcaaccgggagtccggcgcgatcacccag
accttccagacctcgctgccggccggcgtctactgcgacgtccagcacggcgacccggtg
aacggcggcggctgcaccggcccgacccacaccgtcggcacggacggcaggttcaccgcc
accgtcggcgcgggcgacgcggtcgcgctgtacgtcggcgcgggcggcgggtccgccgcg
acgccgaccccgaccccgtccgcttccgcctcggcctcggcctcggccactggcaccggg
aacagcgccaccgtcttctactcgacgaacaggaactggtcggcctacgacctgcactac
gcgcccaccggcggcagttggaccaccgtgcccggcgtcgcgatggacgcggcgtgcacc
ggctgggtgaagaagaccgtcgccctgggcggcgccaccggcctcaccgccaccttcaac
aacggcaacggcacctgggacaacaacggcggcaacaactacccgctgggcgccgggaac
gtcaccgtcaaggacggcgcggtcggctccggcgacccgtgcgcgacggcgtcggcttcg
gcgtcggcgtccgcttcgccgtcggccaccgctgcgccgtcggtcgggaccggcgcgtcc
ttcgcggtgaacgcgaccaccgtggtcggccagaacatctacgtggtcggcgacgcggcc
gagctcggcggctgggacacctcgaaggcgctgccgctctctgccgcggcctaccccgtg
tggaagctggacgcggcgctgaacccgggcaccgcgatccagtacaagtacgtccgcaag
gacgccgccgggaacgtcacctgggagagcggcgccaaccgcaccgcgaccgtcccggcg
agcggcaaggtggtgctgaacgacacctggcggggctga

DBGET integrated database retrieval system