KEGG   Kitasatospora setae: KSE_28920Help
Entry
KSE_28920         CDS       T01648                                 

Gene name
pkaA
Definition
(GenBank) putative serine/threonine protein kinase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH
Motif
Other DBs
NCBI-ProteinID: BAJ28703
NITE: KSE_28920
UniProt: E4NBX2
LinkDB All DBs
Position
complement(3241016..3242896)
Genome map
AA seq 626 aa AA seqDB search
MRPVGSKYVLEDSLGRGATGTVWRGRVREDAAVPGLVPGQAVAVKVLREELAADPDVVMR
FLRERSVLLRLTHPNIVRTRDLVVEGELLALVMDLVDGPDLYRYLRESGPLSPIAGALLM
AQIADALAASHADGVVHRDLKPANVLLATLAVDGDERMHPMLTDFGIARLADSPGITRTH
EFVGTPVYVAPESAEGRPQTAAVDVYGAGIMLYELVTGRPPFQGDNPLAVLQAHLAQEPQ
RPRTMPEPLWTVVERCLRKDPAQRPTAVSLARALRVVAAGVGVHAAPAAVDAALAVGDLL
LPDPALATAAAAGPGAGPHEATLAGVGYDPAAATQVMAHQTGAPATPGAPGAEDRTQLMS
PQPPAGPPADRTRVMPSVPPGAPAQQPPGQQPPAQPEGPHPWQTQLRAARDRNAQTRIGS
FEPDELGEPQVAPRPYQAGQYPQQGRQGQYGQQQPRPYPPQDGRYAPQQGPYRPQQPQQG
RPQYPQPGQGQYPQQGQGQGGRPPVAPPPYQAQQPPQPAPPAAYSGQPQGYGAPQRRPEP
APQHRPEPPYREPEPAREAPREREPRRRSPNRMRIPGLGCLKGCLLVLVVLALGCLALWN
FTPLPHYWDNVVGWYDSARDWVTSHT
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcctgtcggcagcaagtacgtgttggaggacagcctcgggcgcggcgcgaccggg
acggtctggcgcggccgggtccgcgaggacgccgcggtgcccggcctggtccccgggcag
gcggtcgcggtcaaggtgctgcgcgaggaactggccgccgacccggacgtggtgatgcgc
ttcctgcgcgagcgctccgtgctgctccggttgacccaccccaacatcgtccgcacccgc
gacctggtggtcgagggcgagctgctcgccctggtgatggacctggtcgacggccccgac
ctgtaccgctacctgcgcgagtccggcccgctgtcgccgatcgccggcgcgctgctgatg
gcccagatcgccgacgcgctggccgccagccacgccgacggcgtggtgcaccgcgacctc
aagcccgccaacgtgctgctggccaccctcgcggtcgacggcgacgagcggatgcacccg
atgctcaccgacttcggcatcgcccggctcgccgactccccgggcatcacccgcacccac
gagttcgtcggcacccccgtctacgtcgcccccgagtccgccgagggccgcccgcagacc
gccgcggtggacgtctacggcgccggcatcatgctgtacgaactggtcaccggccgcccg
ccgttccagggcgacaacccgctggcggtcctccaggcgcacctcgcccaggagccgcag
cgcccccgcaccatgcccgaaccgctctggacggtggtcgagcgctgcctgcgcaaggac
ccggcccagcgccccaccgccgtctcgctggcccgggcgctgcgggtggtcgcggccggc
gtcggcgtgcacgccgcccccgccgcggtggacgccgcgctggccgtcggcgacctgctg
ctgcccgacccggcgctggccaccgccgccgcggccgggcccggggccgggccgcacgag
gccaccctggccggcgtcggctacgacccggccgccgcgacccaggtgatggcgcaccag
accggcgcccccgctacccccggcgctcccggcgccgaggaccgcacccagctgatgagc
ccgcagccgccggccggcccgcccgccgaccgcacccgggtgatgccctccgtcccgccc
ggcgcccccgcccagcagccgcccggccagcagccgcccgcccagcccgagggcccgcac
ccctggcagacccagctgcgggccgcccgggaccgcaacgcgcagacccggatcggctcc
ttcgagccggacgagctcggcgagccgcaggtcgccccgcgcccctaccaggccggccag
tacccgcagcagggccggcagggccagtacggccagcagcagccccgcccgtacccgccg
caggacggccgctacgccccccagcagggcccctaccgcccgcagcagccgcagcagggc
cggccgcagtacccgcagccgggccagggccagtacccccagcagggccagggccagggc
ggccgcccgccggtcgccccgccgccgtaccaggcccagcagccgccgcagcccgccccg
ccggccgcctacagcgggcagccgcagggctacggcgccccgcagcgccgtcccgagccc
gcgccgcagcaccggccggagccgccgtaccgggagccggagccggcccgggaggcgccc
cgggagcgggagccgcgccgccgcagcccgaaccggatgcggatccccggcctgggctgc
ctgaagggctgcctgctggtgctggtggtgctggcgctgggctgcctggcgctgtggaac
ttcacgccgctgccgcactactgggacaacgtggtcggctggtacgactcggcccgggac
tgggtcaccagccacacctga

DBGET integrated database retrieval system