KEGG   Kitasatospora setae: KSE_40980Help
Entry
KSE_40980         CDS       T01648                                 

Gene name
pheA
Definition
(GenBank) putative prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
ksk  Kitasatospora setae
Pathway
ksk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01130  Biosynthesis of antibiotics
ksk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KSE_40980 (pheA)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     KSE_40980 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT SBP_bac_3 HrpE PBP_like
Motif
Other DBs
NCBI-ProteinID: BAJ29887
NITE: KSE_40980
UniProt: E4NEV1
LinkDB All DBs
Position
complement(4556926..4557861)
Genome map
AA seq 311 aa AA seqDB search
MSATRYTYLGPAGTFTEAALRTLPEAATRELTPVASVSAALDAVRAGEAAGAMVAIENSV
DGAVTTTSDELINGSPLMIYREVLLPISFAVMVRPGTAAGDVKTVSGHPVAQPQVRHWLA
ANLPDAQWESAASNAEAARLVQEGRYDAAVAGAFAAELYGLEVLSDAINPATSPTTRFVL
AGRPGRVSSATGWDKTSMVAWLPDDHPGALLELLQEFAVRGINLMRIESRPTGEGMGSYC
FLFDCEGHLSERRVSEAMMGLKRICPQVRFLGSYPRADKGAASPLRNGTSDLDFANASDW
LSRCLDGRGEL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgacccgttacacctatctcggacccgcgggcaccttcaccgaggccgcgctg
cggacgctgccggaggcggcgacccgggagctgacgccggtggcgtcggtgtcggcggcg
ctggacgcggtgcgggcgggcgaggccgcgggcgcgatggtggcgatcgagaactcggtg
gacggcgcggtcaccaccaccagcgacgagctgatcaacggcagcccgctgatgatctac
cgcgaggtgctgctgccgatctcgttcgcggtgatggtccggcccgggacggccgcgggc
gacgtgaagacggtcagcggccacccggtggcccagccgcaggtgcggcactggctggcc
gcgaacctgccggacgcgcagtgggagtcggcggcgtccaacgcggaggcggcccggctg
gtgcaggagggccgctacgacgcggcggtggcgggcgcgttcgccgccgagctgtacggg
ctggaggtgctgtcggacgcgatcaaccccgcgacctcgccgaccacccggttcgtgctg
gcgggccggccggggcgggtctcctcggcgaccggctgggacaagacctcgatggtggcg
tggctgccggacgaccacccgggcgcgctgctggagctgctgcaggagttcgcggtgcgc
ggcatcaacctgatgcggatcgagtcccggccgaccggcgagggcatgggcagctactgc
ttcctgttcgactgcgaggggcacctgagcgagcggcgggtcagcgaggcgatgatgggc
ctgaagcggatctgcccgcaggtgcgcttcctcggctcctacccgcgggccgacaagggc
gccgcctccccgctccgcaacggcacctcggacctcgacttcgccaacgcctcggactgg
ctctcgcgctgcctggacgggcgcggggagctctga

DBGET integrated database retrieval system