KEGG   Kitasatospora setae: KSE_49500Help
Entry
KSE_49500         CDS       T01648                                 

Gene name
sodN
Definition
(GenBank) putative superoxide dismutase [Ni]
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ksk  Kitasatospora setae
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KSE_49500 (sodN)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KSE_49500 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: BAJ30728
NITE: KSE_49500
UniProt: E4NGU8
LinkDB All DBs
Position
complement(5475582..5475977)
Genome map
AA seq 131 aa AA seqDB search
MFSRLFAPRVTAQAHCDLPCGVYDPAQARIEAESVKATQEKYQANEDAEFRARAIVIKEE
RAELVKHHLSVLHTDYFKAPHFEAYPGLHDLFNRAGKAASAAKASTDPATGQALLDLIAE
IDAIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgtctgtttgctccgcgagtcaccgcccaggcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggccgagtccgtgaaggcgactcaggag
aagtaccaggccaacgaggacgccgagttccgtgctcgcgccatcgtcatcaaggaggag
cgcgccgagctggtcaagcaccacctctcggtgctgcacaccgactacttcaaggccccg
cacttcgaggcctacccgggcctgcacgacctgttcaaccgtgccggcaaggccgcctcg
gccgccaaggcgtccaccgacccggccaccggccaggccctgctggacctgatcgccgag
atcgacgcgatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system