KEGG   Kitasatospora setae: KSE_73470Help
Entry
KSE_73470         CDS       T01648                                 

Gene name
bfmA4
Definition
(GenBank) modular polyketide synthase BFAS4
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N adh_short_C2 PKS_DE Docking Epimerase Polysacc_synt_2 GDP_Man_Dehyd Trypan_PARP RmlD_sub_bind SAT
Motif
Other DBs
NCBI-ProteinID: BAJ33102
NITE: KSE_73470
UniProt: E4NJF4
LinkDB All DBs
Position
8381931..8392241
Genome map
AA seq 3436 aa AA seqDB search
MRDYLNRVTIDLRDTRQRLREAEARSSEPIAIVAMSCRFPGGVRDPEELWDLLAEGRDTS
GPVPGDRGWERVWPAGGTVPGRGAFLDGAADFDPEFFGISPREAVAMDPQQRMLLMASWE
AIERAGIDPLTLRGSRTGVYAAAIDQGYATLGSGAAEAVQGFLMTGNSMSVMSGRVSYAL
GLEGPALTVDTACSSSLVAMHLAARALRAGECSLALAGGVSVMALPAVFVEFSRQGAMSA
DGRCKPFAAAADGTGWGEGVGMLLLERLSDARRNGRTVLAVLRGSAINQDGASNGLTAPN
GPSQQRVIRAALADAGLASADVDAVEAHGTGTTLGDPIEADALLATYGQDRPADRPLLLG
SLKSNIGHTQAAAGVAGVIKTVLALRHGVLPRTLHVDAPTPHADWSAGAVELLTEARDWP
AVDRPRRAAVSSFGMSGTNAHVVLEQAPEPEPVSEPEPVPESEPVDGSAAAPGAVLPWVL
SGRTAAALGEQAARLRARLDADASVRPADTGFSLATTRSAFEHRAVVIGTGRPALLDGLA
ALSAPGTLSGPGAEAAAEPAADVVAGTGRAVEGPTALVFPGQGAQWDGMAVELLDSAPVF
AARIADCERALAPFVDWSLEAVLRGAPGAPGLDRVDVVQPALWAVMVSLAAHWESWGVRP
DAVVGHSQGEIAAAVVAGALTLEDGAQVVALRSRAIRALAGLGGMAAVPLPEEEARALLA
PWAERLSVAAVNGPAAVVVSGETGALAELLAHCEARGVRARSVPVDYASHSAQVERIRSE
VLAALAGVRPLPARIPLYSTVTGDRLDTTAMDADYWYRNLRGTVRFDAAVRALAEQGHEV
FVEVSPHPVLTMALQDTVEATGAAEPPVVVGTLRRDDGGPRRALRSAAELWVAGAAVDWA
AVYAGTGARRTDLPGYPFQLRRYWLEPEAAPATATAADPDDAAFWQMVDHDAPAEIAAHL
AVDEDALAPVLPALRGWRRQRRDESTVDSWRYRVGWQPLPDPPAPAAAGTWLVVLPAGHG
DDTRVRGPLLALTEAGATVVTAELTAGAVRRADLAETLAAALGDRVPTGVLSLLAAADRP
HPDHPALPTGTALTVALVQALGDLALTAPLWCATTGAVSTGPDDPVTHPRQAQVWGTGMV
AALELSARWGGLVDLPPELDARARTRLAAALTAAVPPAAGPTAAGPGREDQLALRPTGLL
ARRLRRAPRNADRSPDRAKPWKPRGTVLLTGGTGAVGPHLARWLARGGAEHLVLPGRRGP
QAPGAAELAAELAALGVRLSLPVCDLADRRAVAALLTGLEAAGDPVTAVVHAAAFVALAP
LDGTPMAAFEQIVAAKAAGAEHLDALLDRELDAFVLFSSIAGVWGSGDHGAYAAANAHLD
ALAQHRRARGLTATSVDWGIWQAENPHRDRAAGDDADLFKLEEHGLPRIAPDLALHALRQ
ALDDDETVLTVADVDWERFAAVFTSTRPSPLLTGVPEARRALEAPAGAPEAPAAAQLRER
LAALGESEQHRLLLDLVRTHAAAVLGHSGADAIRPGTAFQDMGFASLTAVELRNRLNTAT
GLRLPSTLIFDHPSATALAREIRAELLGRPAADPAPAGPDTAAHRPAPDDDLIAIVSMAC
RFPGGIGSPEELWRLLADGGDAVSDFPTDRGWDLEALYDPDPDRPGTSTTRQGGFLHDAA
DFDAEFFGISPREALAMDPQQRLLLETTWEAIERAAIDPVALRGSRTGVFTGVNYADYAA
VVARSEEGDGHLLTGSAPSVVSGRVAYTLGLEGPAVTVDTACSSSLVAMHLAGRALRGGD
CSLALVGGVAVMATPGALISFSRQRGLAEDGRCKAFSDDADGMGMGEGAGVLLLERLSDA
RRNGHPVLAVVRGSAVNQDGASNGLSAPNGPSQQRVIRAALADAGLTSADVDVVEAHGTG
TTLGDPIEAQALLATYGQDRPADQPLLVGSLKSNLGHAQAASGVAGVIKTVLAMRHGQVP
RTLHVDTPSAHVDWTRGALALAAAQQPWPLRGRPFRAGVSSFGLSGTNVHTILEHAPLDD
DAPPAERTPLPEVPWLLSARTPEALRAQADRLRRHLDDNPDSDPRDIGSALHARTAFEYR
KALIGDRDQLPSLLAGMADDEAGAWGGGRPVDGRSVLVFPGQGSQWVGMAVELLAESGVF
AGRMAECDRALAPYVDWSLAQALGSEELLARVDVVQPVLWAVMVSLAEVWRSFGVVADAV
VGHSQGEVAAAVVAGGLSLADGARVVALRSRAVGALAGRGGMASLPLPVGVVRERIGVGL
SVAAVNGPSSTVVSGDADAVAALVAELVEEGVRARLIEVDYASHSAHVEQVRERLLADLD
GITPLSGGVPFFSTVTGGWLDTKSLDAEYWYRNLRETVEFGAATEALLGEGFRFFVESSP
HAVLGVAVGESVEAAGVDAVVLGTLRRGEGGLAQVLRAVGRGWERGLEVDWSGSFPGARR
VELPTYAFQRTRYWPAPAPVTAADVGAAGLDPADHPVLGAAVELADTGELLLSGRISLRT
HPWLADHAVAGVVLLPGAAFAELAVRAADEAGCRAVEELTLQQPLLIPADTAVRLQVRVG
AADADGGRSLDLFSCREDTATPHWTAHATGRLAAASASDATPVSDAGAWPPPGAVPVAVD
DLYERFDASGYGYGPAFRGLTAAWRRGDEIFTEVRLPEDRNRSAAAFGVHPALLDAALQG
LFLNAGPEAGPGADRPSAGLPFSWSGVRLHASGATALRVRLGFRPDGSVSIDAADPHGLP
VVSVEALAVRPIDLDALRPGGGPESLYRLRWSVAPASGPAAPLGAWAVLGGRESFPDSHP
DLAALGAALDAGAPPPAAVLAWCDHAPPLPSSPPDAAAVHAALDDALRLVQDWLADPRWD
DGTRLVLVTRGAVPAADGEQVTDLTAAAVRGLVRSAQSEHPDRFLLIDTDDPAAVAGLLP
QALALAGTEPQLAIRAGRLLTARLTRAAAEPDPDPGLPSAIGAAGGTVLVTGAGGALGGL
VAEHLVAAHGVRNLLLVGRRGADTPGLADLAAELRGRGARVDLAACDVADRDALAALLAG
IPADRPLSAVVHAAGVLDDGTVESLTPGRMRPVLRPKVDAALHLHALTRDLPLSAFALFS
SASATVGNAGQGNYAAANAFLDALAQHRRALGLPAQSLAWGLWARRGAMTGTLSATDLRR
MARGGTSALGSEEGLALFDAALTLDEPLLVPVRIDLGRLRTAARTGPVPALLSALVPGAA
RRPASGADAAEADSLRRRLAALSPEDRLAALLDLVRSRVADVLGHGTAAAVDPDQAFKDL
GFDSLTSVELRNRLGAATGRRLPATLVFDHPTPAAVAAHLAGRLVPDGPGGPGGPGGPAA
GTPGRPDPADHEIGSLLAAIPPAALRRAGLLDALLALADRPDAPGTPAPATAPAAADIHG
MAVDDLVRMALGGDRD
NT seq 10311 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacctcaaccgggtgaccatcgacctccgggacacccggcagcggctccgg
gaggccgaggcccgcagcagcgagccgatcgcgatcgtggcgatgagctgccgcttcccc
ggcggggtccgcgacccggaggagctgtgggacctgctcgccgaaggccgcgacaccagc
gggcccgtccccggcgaccggggctgggagcgggtctggccggccgggggcacggtcccc
gggcggggggcgttcctggacggcgcggccgacttcgacccggagttcttcggcatctcg
ccccgcgaggcggtcgcgatggacccgcagcagcggatgctgctgatggcctcctgggag
gcgatcgaacgggccggcatcgacccgctcaccctgcgcggcagccgcaccggggtgtac
gccgccgccatcgaccaggggtacgcgacgctgggctccggcgccgccgaagccgtccag
gggttcctgatgacggggaactcgatgagcgtgatgtccggccgggtgtcctacgcgctc
ggcctggagggccccgccctcaccgtggacaccgcctgctcgtcctcactggtggccatg
cacctcgcggcccgggcgctgcgggccggcgagtgctcgctcgccctggccggcggggtc
agcgtgatggcgctgccggcggtgttcgtcgagttcagccggcagggcgcgatgtccgcc
gacggccgctgcaagccgttcgcggccgccgccgacggcaccggctggggcgagggcgtc
ggcatgctgctgctggagcggctctccgacgcccggcgcaacggccgcacggtgctggcc
gtgctgcgcggttcggcgatcaaccaggacggtgccagcaacggcctgaccgccccgaac
ggcccgtcccagcagcgggtgatccgggccgcgctggccgacgcgggcttggcgtccgcc
gacgtcgacgcggtcgaggcgcacggcaccggcaccaccctcggcgacccgatcgaggcc
gacgcgctgctcgccacctacggccaggaccggcccgccgaccggccgctgctgctcggc
tcgctgaagtccaacatcgggcacacccaggccgccgccggcgtcgccggggtgatcaag
acggtcctcgcgctgcggcacggcgtcctcccgcgcaccctgcacgtggacgcgcccacc
ccgcacgccgactggtccgcgggcgccgtcgaactcctcaccgaggcccgcgactggccc
gccgtcgaccgtccgcgccgggccgccgtctcctcgttcggcatgagcggcaccaacgcg
cacgtcgtcctcgaacaggcaccggagccggaaccggtgtcggagccggaaccggtgccg
gagtccgagccggtcgacgggtcggcggccgcgcccggggccgtgctgccctgggtgctg
tccggccgcaccgcggccgcgctcggcgagcaggcggcccggctgcgggcccggctcgac
gcggacgcctccgtccggccggccgacaccgggttctcgctggcgaccacccggtccgcc
ttcgaacaccgggccgtggtcatcggcaccggacggcccgccctgctggacggcctcgcc
gccctgtccgcccccggcaccctgtccggccccggtgcggaagccgccgccgaaccggcc
gccgacgtcgtcgcgggcaccggccgggccgtcgagggcccgaccgccctggtgttcccc
ggccagggcgcccagtgggacggcatggccgtcgaactcctcgactccgcaccggtgttc
gccgcccggatcgcggactgcgaacgcgccctggcgcccttcgtcgactggtcgctggag
gccgtcctgcgcggcgcccccggtgcgccgggactcgaccgggtcgacgtggtccagccc
gcgctgtgggccgtcatggtctcgctcgccgcccactgggagtcctggggcgtccggccg
gacgccgtcgtcggccacagccagggcgagatcgcggccgccgtggtggcgggggcgctc
accctggaggacggcgcgcaggtcgtcgcgctgcgcagccgggcgatccgcgcgctggcc
ggactcggcggcatggccgccgtcccgctgcccgaggaggaggcccgcgccctgctcgcc
ccctgggccgaacggctgtcggtggccgccgtcaacgggcccgccgccgtggtggtctcc
ggcgagaccggcgccctggccgaactgctggcccactgcgaggcgcgcggcgtccgggcc
cggtccgtccccgtggactacgcctcgcactccgcccaggtcgagcggatccgctccgag
gtgctggccgcactggccggcgtgcgcccgctcccggcccggatcccgctgtactccacc
gtcaccggcgaccggctcgacaccaccgccatggacgccgactactggtaccgcaacctg
cgcggcaccgtccgcttcgacgcggccgtccgcgccctggccgagcagggccacgaggtc
ttcgtcgaggtgtcgccgcacccggtgctgaccatggccctccaggacaccgtcgaggcc
accggcgccgccgagccgcccgtcgtcgtcggcaccctgcgccgcgacgacggcggaccg
cgccgggccctgcgctcggccgccgaactgtgggtggcgggcgcggccgtcgactgggcc
gccgtgtacgccggaaccggcgcccgccgcaccgacctgcccggataccccttccaactg
cgccgctactggctggaaccggaggcggcgcccgccaccgcgacggccgccgacccggac
gacgcggcgttctggcagatggtcgaccacgacgccccggccgagatcgccgcccacctc
gccgtcgacgaggacgccctggcccccgtcctgcccgccctgcgcggctggcgccggcag
cggcgcgacgagagcaccgtcgactcctggcgctaccgggtcggctggcagccgctgccc
gacccgccggcccccgccgccgccggcacctggctggtcgtcctgcccgccgggcacggc
gacgacacccgggtgcgcggcccgctgctcgccctcaccgaagcgggcgccaccgtcgtc
acggccgaactcacggccggcgccgtccgccgcgccgacctcgcggagacgctcgccgcc
gccctcggcgaccgcgtcccgaccggcgtgctgtccctgctggccgccgccgaccggccc
caccccgaccacccggccctgcccaccgggacggccctcaccgtcgccctggtccaggcc
ctgggcgacctcgccctcaccgcccccctctggtgcgccaccaccggggccgtgtccacc
ggcccggacgacccggtcacccacccccgccaggcgcaggtctggggcaccggcatggtc
gccgcgctcgaactgtccgcccgctggggtggactcgtcgacctgccgcccgagctcgac
gcccgcgccaggacccggctcgccgccgccctgaccgccgccgtcccgccggccgccggg
ccgaccgccgccggccccggccgcgaggaccagctcgccctgcgccccaccggcctgctg
gcccgccgcctccggcgcgcgccccggaacgccgaccggagccccgaccgcgcgaagccc
tggaagccgcgcggcaccgtcctgctgaccggcggcaccggcgccgtcggcccgcacctc
gcccgctggctggcccgcggcggcgccgagcacctcgtcctccccggccgccgcggcccg
caggcccccggcgcggccgaactcgccgccgaactggccgccctcggcgtccggctgagc
ctgccggtctgcgacctggcggaccgccgggcggtggccgcgctgctcaccggcctggag
gcggcgggcgacccggtcaccgcggtcgtccacgcggccgccttcgtcgcgctcgccccc
ctggacggcacgccgatggccgcgttcgaacagatcgtcgccgcgaaggcggccggcgcc
gaacacctcgacgccctgctcgaccgcgaactcgacgccttcgtcctgttctcctcgatc
gccggagtctggggcagcggcgaccacggcgcctacgccgccgccaacgcccacctcgac
gccctggcccagcaccgccgggcccgcggcctcaccgcgaccagcgtcgactggggcatc
tggcaggccgagaacccccaccgggaccgcgccgccggggacgacgccgacctgttcaaa
ctggaggagcacggcctgccccggatcgcccccgacctcgcgctgcacgccctgcgccag
gccctcgacgacgacgagaccgtcctcaccgtcgccgacgtcgactgggagcggttcgcc
gccgtcttcacctccacccgccccagcccgctgctgaccggcgtccccgaagcccgccgc
gccctggaggccccggccggcgccccggaggcccccgccgccgcccaactgcgcgaacgg
ctcgccgccctcggcgagtccgagcagcaccgcctgctgctcgacctggtccgcacccac
gcggcggccgtcctcggccacagcggggcggacgcgatccggcccggcacggccttccag
gacatgggcttcgcctccctcaccgccgtcgaactccgcaaccggctcaacaccgccacc
ggactgcgactgccctccaccctgatcttcgaccacccgtcggccaccgcgctcgcccgg
gagatccgcgccgaactgctcggccgaccggccgccgacccggcccccgccggcccggac
accgccgcgcaccggcccgcgcccgacgacgacctgatcgcgatcgtctcgatggcctgc
cgcttccccggcggcatcggcagccccgaagagctgtggcggctgctcgccgacggcggc
gacgccgtctcggacttccccaccgaccggggctgggacctcgaagccctctacgacccc
gaccccgaccgccccggcacctcgaccacccggcagggcggcttcctgcacgacgccgcc
gacttcgacgccgagttcttcggcatctcgccgcgcgaggccctcgcgatggacccgcag
cagcggctgctgctggagaccacctgggaggcgatcgagcgcgccgccatcgacccggtc
gccctgcgcggcagccgcaccggcgtgttcaccggcgtcaactacgccgactacgcggcc
gtcgtcgcccggtccgaggaaggggacggccacctgctcaccggcagcgcgcccagcgtc
gtctccggccgggtcgcctacaccctgggcctggagggccccgccgtcaccgtcgacacg
gcctgctcctcctcactggtggccatgcacctcgcgggccgggcgctgcgcggcggcgac
tgctcgctcgccctggtcggcggcgtcgccgtgatggcgacccccggcgccctgatcagc
ttctcccggcagcggggcctcgccgaggacggccgctgcaaggcgttctcggacgacgcg
gacggcatgggcatgggcgagggcgccggcgtcctgctgctggagcggctctccgacgcg
cggcgcaacgggcacccggtgctggccgtggtccggggctcggccgtcaaccaggacggc
gccagcaacggcctctccgcccccaacggcccgtcgcagcagcgcgtcatccgggcggcg
ctcgcggacgccgggctgacgtcggcggacgtcgacgtggtggaggcgcacggcaccggc
accaccctcggcgacccgatcgaggcgcaggccctgctcgccacctacggccaggaccgg
cccgccgaccagccgctgctggtcggctcgctcaagtccaatctcggccacgcgcaggcc
gcctcgggcgtggcgggcgtcatcaagacggtcctggccatgcggcacggccaggtgccc
cgcaccctgcacgtcgacacgccctccgcccacgtcgactggacgcgcggagcactcgcc
ctcgcggccgcacaacagccctggccgctgcgcggacgccccttccgggccggcgtctcc
tccttcggcctgagcggcaccaacgtccacaccatcctcgaacacgccccgctggacgac
gacgccccgcccgccgagcgcacccccctcccggaggtgccctggctgctgtccgcccgc
acccccgaggccctgcgcgcccaggccgaccggctgcgccgccacctggacgacaacccc
gactccgacccgcgcgacatcggctccgccctgcacgcccgcaccgccttcgagtaccgg
aaagccctgatcggcgaccgggaccaactcccctccctgctggccggcatggccgacgac
gaagcgggagcgtggggcggcggccgtccggtcgacggccgctcggtgctggtgttcccg
gggcaggggtcgcagtgggtggggatggcggtggagctgttggccgaatcgggggtgttc
gcggggcggatggcggagtgtgatcgtgcgctggcgccgtacgtcgactggtcgttggcg
caggcgctgggttccgaggagctgttggcgcgggtggatgtggtgcagccggtgctgtgg
gcggtgatggtctcgctcgcggaggtctggcgctcgttcggggtggttgcggacgcggtg
gtgggccactcgcagggggaggtcgcggccgcggtcgtggcgggtgggttgagcttggcg
gacggggcgcgggtggtggcgttgcgttcgcgtgcggtgggggcgttggcgggtcggggc
gggatggcgtcgttgccgctgccggtgggggtggtccgcgagcggatcggggtcgggttg
tcggtggcggcggtgaacggtccgtcgtcgacggtggtgtcgggtgacgcggacgcggtg
gccgcgttggtggcggaactcgtcgaggagggggtgcgggcgaggctgatcgaggtcgac
tacgcctcgcactcggcgcacgtcgagcaggtccgcgagcgtctgctcgccgacctggac
ggcatcacgccgttgtcgggtggggtgccgttcttctcgacggtgacgggcgggtggttg
gacacgaagtcgctggacgccgagtactggtaccggaatctgcgggagacggtggagttc
ggggcggcgacggaggcgttgctgggggagggtttccggttcttcgtggagtcgagtccg
cacgcggtgctgggtgtggcggtgggggagtcggtggaggccgcgggggtggacgcggtg
gtgttggggacgttgcgtcgtggtgagggtggtctggcgcaggtgttgcgtgcggtgggt
cgtggttgggagcgggggttggaggtcgactggtcggggtcgttcccgggggcgcggcgg
gtcgagctgccgacgtacgcgttccagcgcacccgctactggcccgcgccggcgcccgtc
actgcggccgacgtgggcgcggccggactcgatccggccgaccaccccgtgctgggcgcg
gccgtcgagctggccgacacgggtgagctgctgctcagcggccggatctcgctgcgcacc
cacccctggctcgccgatcacgcggtggcgggcgtcgtgctcctgcccggcgcggccttc
gcggaactcgccgtccgcgcggcggacgaggccggatgccgcgcggtggaggaactgacc
ctccagcagccgctgttgataccggccgacaccgccgtccggctacaggtgcgggtcggc
gcggcggacgcggacggcggccgttccctggacctgttctcctgccgggaggacacggcc
accccgcactggaccgcgcacgcgaccggccggctcgccgccgcctccgcctccgacgcc
acccccgtctccgacgccggcgcctggcccccgcccggtgccgtcccggtcgccgtcgac
gacctgtacgagcggttcgacgcctccggttacggctacgggcccgccttccgcgggctc
accgcggcctggcgccggggcgacgagatcttcaccgaggtgcgcctgcccgaggaccgc
aaccggtccgccgccgccttcggcgtgcaccccgcgctgctggacgccgccctccagggg
ctgttcctgaacgccgggccggaggccggtcccggtgcggaccggccgtccgccggactg
ccgttctcctggagcggagtcaggctgcacgcctccggggccaccgcactcagggtccgg
ctcggcttccggccggacgggtcggtgtcgatcgacgcggccgacccgcacgggctcccg
gtcgtgtcggtcgaggcgctcgccgtccggccgatcgacctcgacgccctgcgccccggc
ggcggaccggaatccctctaccggctgcgctggtcggtggcgcctgccagcgggcccgcc
gcccccctcggggcctgggccgtcctcggcggccgggagtccttcccggacagccacccg
gacctggccgcgctcggcgccgcgctggacgcgggggcgccgccgcccgccgccgtcctg
gcctggtgcgaccacgccccgccgctcccgtcgtccccgcccgacgccgccgccgtgcac
gccgcgctggacgacgccctgcggctcgtccaggactggctggccgacccgcgctgggac
gacggcacccggctcgtgctcgtcacccggggcgcggtcccggcggcggacggcgagcag
gtcaccgacctcaccgccgccgccgtccgcggcctggtccgctccgcccagtccgagcac
ccggaccgcttcctgctgatcgacaccgacgacccggccgccgtggccggcctgctcccg
caggccctggccctggccggcaccgaaccccagctggcgatccgcgccggacggctcctc
accgcccgcctcacccgggccgccgccgagccggacccggaccccggcctgccgtccgcc
atcggcgcggccggcggaaccgtcctggtcaccggggccggcggcgcgctcggcggcctg
gtggcggagcacctggtggccgcgcacggcgtgcggaacctgctgctcgtcggccggcgc
ggcgcggacaccccgggcctggccgacctcgcggccgaactgcgcggccgcggcgcccgg
gtggacctggcggcctgcgacgtcgccgaccgggacgcgctcgccgccctgctcgccggg
atccccgccgaccgcccgctgagcgcggtcgtccacgcggccggcgtcctggacgacggc
acggtcgagtcgctgacccccggccggatgcgccccgtcctgcgacccaaggtcgacgcg
gccctccacctgcacgccctcacccgcgacctgccgctgtcggccttcgccctcttctcc
tccgcgtccgccaccgtcggcaacgccggacagggcaactacgcggccgccaacgccttc
ctcgacgcgctcgcccagcaccggcgcgccctgggcctgcccgcccagtcgctcgcctgg
ggcctgtgggcccggcgcggcgccatgaccggcacgctcagcgccaccgacctgcggcgg
atggcccggggcggcacctcggccctcggcagcgaagagggcctggccctgttcgacgcg
gcgctcaccctggacgaaccgctgctcgtcccggtccggatcgacctcggccggctccgg
acggcggcccggaccgggcccgtcccggcgctgctctccgccctggtccccggggccgcc
cgccgccccgcctccggggcggacgccgccgaggccgactcgctgcgccgccggctggcc
gcgctctccccggaggaccgcctcgccgccctgctcgacctggtgcggagccgggtcgcc
gacgtcctcggccacggcacggccgcggccgtcgacccggaccaggcgttcaaggacctc
ggcttcgactcgctcacctccgtcgagctccgcaaccggctcggcgccgcgaccggccgc
cgactgcccgcgaccctggtcttcgaccaccccaccccggccgccgtcgccgcccacctc
gccgggcggctggtccccgacgggccgggcggaccgggaggaccgggcgggcccgccgcc
gggacaccgggccggccggaccccgccgaccacgagatcggctccctgctcgccgcgatc
ccgcccgccgccctgcgccgggccggcctgctggacgcgctgctggccctcgccgaccgc
ccggacgcacccgggacgcccgcccccgccaccgctcccgccgccgccgacatccacggc
atggccgtcgacgacctcgtccggatggccctgggcggcgaccgtgactga

DBGET integrated database retrieval system