KEGG   Candidatus Kuenenia stuttgartiensis: KSMBR1_1820Help
Entry
KSMBR1_1820       CDS       T05435                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kst  Candidatus Kuenenia stuttgartiensis
Pathway
kst00620  Pyruvate metabolism
kst00680  Methane metabolism
kst01100  Metabolic pathways
kst01120  Microbial metabolism in diverse environments
kst01200  Carbon metabolism
Module
kst_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KSMBR1_1820
  09102 Energy metabolism
   00680 Methane metabolism
    KSMBR1_1820
Enzymes [BR:kst01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KSMBR1_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: SOH04319
UniProt: Q1PXR4
LinkDB All DBs
Position
MBR1:1975943..1977415
Genome map
AA seq 490 aa AA seqDB search
MRKIPRTMSTQHPDNVIMPFFTEGAPFHGEDEIKEAYYVFSHLRCDEQMWDCEGKEVDEF
VIKKLLTRYENFFKNKRIGKDLFITLRAPNPAYEMSEAKILLETLESAPRSYDTARIFYG
DGAVPPIFEVIIPMTTNADIINRVYHYYHDFVVGKQYKKCFSGDITIREWIGEFMPETIE
VIPLVEDVQYMLSADAIVQDYLKDKNFPYQRVFLGRSDPALNYGFLPAVLVVKIALQRLN
LLQEKLKIPIYPILGVGSNLFRGNMTPFNVKECLNEYPSVQTFTIQSAFKYDYDEEVVRK
AVETINNQERKPPVVIDEETALDITKRLSSAYREQIKELAPLIGDIARFVPRRRMRKLHI
GLFGYSRNVEGITLPRVISFCAALYSIGLPPELLGLHALTGKDLSFLKTAYPGFFEDISI
AASYYNEDVKKLISPKIAKDIEKALGVTNYVENLLHSEYTTQIINALLSKKEETVSENII
SAGKVRGFLG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaataccgagaacaatgagtacgcagcatcccgacaatgtaataatgccgttt
tttacggagggagccccttttcatggcgaagatgaaataaaagaggcatattatgtgttt
tctcatttgcgatgtgatgaacagatgtgggattgcgaagggaaggaagtggatgaattt
gtcatcaagaagttgctcacgcggtatgaaaattttttcaaaaacaagaggattggcaag
gatctgtttattaccttgcgcgcgccgaatccggcgtatgagatgagtgaggcaaaaata
cttcttgaaaccctggaaagcgccccgcgttcctacgataccgccaggatattttacgga
gatggcgcggtgccgcctatttttgaagttattattcccatgacgaccaacgctgatatc
ataaaccgcgtatatcattattatcatgattttgtggtgggcaaacagtataagaaatgt
ttcagcggagatattaccatcagggaatggattggcgagtttatgccggagactatagag
gttattcccctggttgaagatgtccaatatatgctttctgccgatgccatagtacaggat
tatttgaaagataaaaactttccctatcagcgagttttcctcggacgttctgatcccgcg
ctgaactacggttttctgcctgccgtactggtggtaaaaatcgccttgcaaagattaaac
ctgttgcaggaaaagcttaaaattccgatatatcccattcttggcgtaggctccaacctt
tttcggggaaacatgacgccgtttaacgtgaaagaatgcctcaatgaatacccgagcgtt
cagacgtttaccatacaatctgcctttaagtatgactacgatgaggaagtagtcagaaag
gctgttgaaacaatcaataatcaggaaagaaagccgccggtggtaattgacgaagaaacc
gcattggatattacgaaaagattatcgtccgcttaccgggagcaaatcaaggagcttgca
cctttgatcggtgatatagcgcggtttgttcccaggagaaggatgcgcaagctgcatatc
gggctctttgggtattcaagaaacgtggaggggattaccctgccaagggtaatatctttt
tgcgccgccttgtattcgattggattaccgcctgaattgttagggctgcacgccctcacc
gggaaagacctctcatttcttaaaacagcgtatcccggtttctttgaagatatttcgata
gctgcgtcctactacaatgaagacgttaaaaaactaatatctccaaaaattgcaaaggat
attgaaaaagcattgggcgtgacaaactatgtagaaaatctcctgcatagcgaatatacc
acccaaatcatcaatgccctgctttcaaaaaaagaggaaaccgtttctgaaaacattatt
tccgctggaaaggtgaggggattccttggataa

DBGET integrated database retrieval system