KEGG   Kurthia sp. 11kri321: ASO14_1395Help
Entry
ASO14_1395        CDS       T04250                                 

Definition
(GenBank) AAA domain protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
kur  Kurthia sp. 11kri321
Brite
KEGG Orthology (KO) [BR:kur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kur03400]
    ASO14_1395
DNA repair and recombination proteins [BR:kur03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ASO14_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 SMC_N AAA_21
Motif
Other DBs
NCBI-ProteinID: AMA64555
UniProt: A0A0X9VHZ2
LinkDB All DBs
Position
1333735..1336806
Genome map
AA seq 1023 aa AA seqDB search
MKPIRLSMTAFGPYKEKETIDFTKLQGNQIFVISGATGAGKTTIFDGICFALYGSVSGEE
RENAKTHRSNFAADDTHTAIELVFEMKGKTYRILRQLAHVKAGNKTATGEKTEFVEITDE
GEIPVLDSHRVRDLNDRLEEIIGLTKEQFKQIVMLPQGEFRKLLTSDSRNKEQILRKIFK
TEHFEEMTKRLKDKKTEAEKQLLALETERATFIRQIKETLPEADRPLFHVFAKEYQSSVQ
IIEGLQHEQVYYEAEEKKVQTVHAEKQQLFTEKQQMVHAAEQFNLTLEEYQKVAAKYKEL
LQREAEIESIQQQLKQAERAEHIIPYEQAFREQRKRTEQLTERVAFAKQQLQQAIEKRNV
AKEAQANIEQQLPLYEKQKEQLREWQRILPFYEAVNQLEQQYKEQQHQLAKATTNKEQYD
IQLQQAITRVKQAEEQYDVLMKQLIDETAYYEQLTQLKQVEQLLSAQREQRHKLKELTTQ
HDMASTQLQEQNTKLHQVEEQWLANQAYVLAEQLVVGEICPVCGNTVKEKIQQTQTGKIT
KEIVEQAKITQQQAEQKARQIQTQVDILNSDMQKTAEALQQVTVAYDEATNVETIQKLEQ
TLNKNNQQKIQAQELQQQLTQFRKQVEQLREQQQVCLQQVNQFQMTVHTTELQLQDKKQQ
LPVAFATKQQVDEAIHEITQQVALYEQQTKQVNEAYEVAMQQHTTQEANVQNMKQQHVEA
QEQLSQLQQQLQEKVLAAGFQDGKEYTAARLETAQMNALQERITQYEKERYATEEYLEKQ
QHLAQAEKKNVEVLKEELLTIKEQVDLYVKQLHQIESYRQSITRFIRYLEQAQEKSAQLE
ERASQIIQLYDLMAGKNAQKISFERYLQIEYLEQIIQAANERLVPLTNGQYRLLRSERVD
SNGKQSGLSLDVYDAYTGQERDVKTLSGGEQFNASLCLALGMSDIIQSFRGNVQMDTMFV
DEGFGTLDEEALSKAIDTLVDLQKTGRMIGIISHVAELKETVPATLEVRKTKEGYSHTTW
NIK
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaattcgtttaagtatgactgcatttggtccatataaagagaaagaaactatt
gattttacgaaactacaaggtaatcaaattttcgtcatttcaggtgcgacaggcgcaggg
aaaacaacgatttttgatgggatttgttttgcactctatggaagtgtaagtggtgaagag
cgtgaaaatgcgaaaacacatcgtagtaattttgcggcagatgatacgcatacagcgatt
gaattagtgtttgaaatgaaggggaagacttatcgtattttacgccaattagcccatgta
aaagcaggaaataagacagctacaggtgagaaaacggaatttgttgagataacagatgag
ggtgagattcctgtacttgattcgcatcgtgtacgtgatttgaacgatcgtttagaggag
attattggcttaacaaaagaacaatttaaacagattgttatgttaccgcaaggggaattt
cgtaaactattaacgtccgattcacgcaataaggagcaaatcctgcgtaaaatctttaaa
acagaacattttgaagaaatgacaaaacgcttaaaagataaaaaaacagaagctgaaaag
caattacttgcgttagaaacagagcgtgcaacatttattcgtcaaataaaagaaacatta
ccagaagcggatcgcccactatttcatgtatttgcaaaagagtatcaatcatctgtacaa
atcattgaagggttacaacatgaacaagtgtactatgaggcagaagaaaagaaagtacaa
accgttcatgcagagaaacaacagctatttacagagaaacaacagatggtacatgcggca
gagcagtttaacctaacattagaggaatatcaaaaagtagcagcgaagtataaagagctt
ttacaacgcgaagcggaaatagagtcgattcaacagcagttgaaacaagcggagcgagca
gagcatattattccgtatgagcaagcttttcgtgaacaacgaaaacgaacggaacaatta
acagagcgtgttgcgtttgcaaaacaacaattacaacaagcgattgaaaaaagaaatgta
gcaaaagaagcacaggcgaatatagaacagcaattgcctctttatgaaaaacaaaaagaa
caattacgtgaatggcaacgtattttaccattttacgaagcggttaatcaattagaacag
cagtataaagaacagcaacatcaattagcgaaagcaacaacaaacaaagaacaatatgat
atccaattacaacaagcaatcacgcgagtaaagcaagcagaggaacagtatgatgtattg
atgaagcagttgattgacgaaacagcttactacgaacagttaacacagctaaagcaagta
gaacaactattatctgcacagcgagagcagcgccataaactaaaagagttaacaacacaa
catgacatggccagtacgcagttacaagagcaaaatacaaaactacatcaagtagaagaa
caatggcttgctaatcaagcgtatgtcttagcagaacaactagttgtaggcgaaatttgt
cccgtatgtggaaatacagtgaaagaaaagatacaacaaacacaaacagggaaaatcacg
aaagaaatcgttgagcaagctaaaataacacaacaacaagcagagcaaaaagcacgtcag
attcaaacacaagtagatattttaaatagcgatatgcaaaaaacggcggaggcattacaa
caagtaacggttgcatatgatgaagcaacaaatgttgaaacaattcaaaaacttgaacaa
actcttaataagaataaccaacaaaaaatacaggcgcaggaattacaacaacagttaacg
caattccgcaaacaagtggagcaattacgtgaacaacagcaagtatgtttacaacaagta
aatcaattccaaatgaccgttcatacaacagagctacaattacaggacaaaaagcaacaa
ttacccgtggcatttgcgacgaaacaacaagttgatgaagcgattcatgaaattacacag
caagtagcgctatatgagcaacaaacaaaacaagttaatgaagcatatgaagtagcgatg
caacaacatacaacgcaagaagcaaatgtgcaaaatatgaagcaacagcatgtagaagca
caggagcagctatcacaattgcaacaacaactacaagaaaaagtattagcagcaggcttc
caagacggaaaagaatatacagccgcacgtttagaaacagctcaaatgaatgcacttcaa
gaacgaattacacagtatgaaaaagaacgctatgcgacggaagaatatttagaaaaacaa
caacatttagcacaggcagagaagaagaatgttgaggtgctaaaagaagaactacttact
ataaaagaacaagtcgatttatacgtgaagcaacttcatcaaattgaaagctatcgccaa
tctattactcgctttattcgttatttagaacaggcgcaagagaagtcagcgcaattagaa
gaacgagcaagtcaaattattcaactatatgacttaatggcggggaaaaatgcacaaaaa
atttcgtttgagcgttatttgcaaattgaatatttagagcaaattatacaagcggcgaat
gaacgattagtgccattaaccaatggacagtatcgcctgcttcgtagtgagcgcgtcgat
tcgaatggtaagcaatctggtttgagtttagatgtatatgatgcttatacaggtcaagaa
cgtgatgttaaaacattatcaggtggcgaacaatttaatgcatctctttgtttagcacta
ggtatgagtgatatcattcaaagtttccgagggaatgtccaaatggatacgatgtttgta
gatgaaggctttggtacattagatgaagaagcactttcaaaagcaattgatacattagtc
gatttacaaaaaacggggcgtatgattgggattatttcgcacgttgcagaattaaaagaa
acggttccagccacacttgaagttcgtaagacaaaagaaggatacagtcatacaacgtgg
aatataaaatag

DBGET integrated database retrieval system