KEGG   Kurthia sp. 11kri321: ASO14_141Help
Entry
ASO14_141         CDS       T04250                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kur  Kurthia sp. 11kri321
Pathway
kur00250  Alanine, aspartate and glutamate metabolism
kur00410  beta-Alanine metabolism
kur00430  Taurine and hypotaurine metabolism
kur00650  Butanoate metabolism
kur01100  Metabolic pathways
kur01110  Biosynthesis of secondary metabolites
kur01120  Microbial metabolism in diverse environments
kur02024  Quorum sensing
Module
kur_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ASO14_141
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASO14_141
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASO14_141
   00430 Taurine and hypotaurine metabolism
    ASO14_141
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ASO14_141
Enzymes [BR:kur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ASO14_141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUF4481
Motif
Other DBs
NCBI-ProteinID: AMA62559
UniProt: A0A0X1RVM4
LinkDB All DBs
Position
131686..133074
Genome map
AA seq 462 aa AA seqDB search
MKKKHLPDDASPLYGSLASGKDVVLKKLRKKPISAHIAYQLIKDQLIDEGNARQNLATFC
QTYMEPEVTKLMSETMEKNAIDKSEYPEVARLETSCVNVLADLWNAPDAEEVMGTSTVGS
SEACMLGGMAMKFRWRNLARERGLDLNAQKPNLVISSGYQVCWEKFCVYWDIEMREVPMD
EEHLSINLDKVMDYVDEYTIGIVGILGITYTGKFDDIEALDQLVEKYNETHEHQLVIHVD
GASGAMFVPFVDPDLAWDFRLKNVVSINTSGHKYGLVYPGVGWILWRNQEYLPKELIFDV
SYLGGNMPTMAINFSRSASQVVGQFYNFYRLGYEGYREIHKHSQKAAMNISKAIEETGLF
KLYNDGENLPIVCYTLKEDADVSWNLYELADRLQMKGWQVPAYPLPADLDDIVIQRFVCR
ADLGQNLADSLIEDFLQCIEDLNHARVLFHDDDEPHVHGFTH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaacacttaccagatgatgcaagccctttgtatggttcgttagcatcaggt
aaagacgttgttttgaaaaagttacgtaaaaaaccaattagtgcccatattgcctatcaa
ttaattaaggatcagttaattgatgaaggaaatgcaagacaaaacttagcgactttttgt
caaacatatatggaaccagaagtcacaaaattaatgtctgaaacaatggagaaaaatgca
attgataaatcagaatatccagaagtagcacgcttagaaacgagttgtgtgaatgtacta
gctgatttatggaatgcaccggatgccgaggaagtgatgggaacgtctactgttggttca
agtgaagcttgtatgcttggcggtatggcaatgaagtttcgttggcgaaatcttgcacgt
gaacgcggactcgatttaaatgcacaaaaaccaaatcttgtgatttcttcaggttatcaa
gtatgttgggaaaaattctgtgtctattgggatattgagatgcgtgaagtaccaatggat
gaagaacatttaagcattaatttagataaggtaatggattatgtagatgagtacacaatt
ggaattgtgggtatcttaggtattacgtacacaggtaagtttgatgatattgaggcgctc
gatcaacttgttgaaaagtacaacgaaacacatgaacatcagcttgttatccatgtagac
ggtgcaagtggtgcaatgtttgtaccattcgttgatcctgatcttgcatgggatttcaga
ttgaaaaatgttgtatcaattaatacatctgggcataaatatgggcttgtatatccaggt
gttggctggattttatggcgaaatcaagaatatctaccaaaagaattaatttttgatgtg
agctatctaggagggaatatgccaacaatggcgattaacttctctcgtagtgcgagtcaa
gttgtgggccaattctataatttctaccgtttaggatatgaagggtatcgtgagattcat
aaacattcacagaaagcagccatgaatatctcaaaagcaattgaagagacaggactcttt
aaattgtataatgatggcgaaaatctgcccattgtttgttatacgttgaaagaagatgcc
gatgtatcttggaatttatatgaattagctgaccgtcttcaaatgaaggggtggcaagtt
ccagcatatccattaccagccgatttagatgatattgtcattcaacgttttgtatgtcga
gccgatttaggtcaaaacctagcagactctttaatagaagatttcttacagtgtatcgaa
gatttaaatcatgcacgtgtcttattccacgatgatgatgaaccacatgtacatgggttt
acacactaa

DBGET integrated database retrieval system