KEGG   Kurthia sp. 11kri321: ASO14_1952Help
Entry
ASO14_1952        CDS       T04250                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kur  Kurthia sp. 11kri321
Brite
KEGG Orthology (KO) [BR:kur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASO14_1952 (ahpF)
Enzymes [BR:kur01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ASO14_1952 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 FAD_oxidored HI0933_like Thioredoxin_3 DAO FAD_binding_3 Thi4 NAD_binding_7 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AMA64089
UniProt: A0A0X1RZW3
LinkDB All DBs
Position
complement(1890206..1891756)
Genome map
AA seq 516 aa AA seqDB search
MLLDDQIKTQLKQYLAMLEGDLVLKVHVGEDETSKNMLELVQTLDDMSPRITIEHAELER
TPSFSVNRVGEDTGVIFAGLPLGHEFTSLVLALLQVSGRAPKIDESTVKRIQAIKEPMNF
ETYVSLTCHNCPDVVQALNIMSVLNPNITHTMIEGGAFKSEVEEKEIMAVPAVYRDKDFF
EGGRMTLDDILDKLGSTVDAAEFNDKEPFDVLVVGGGPAGASAAVYAARKGVRTGIVAER
FGGQVNDTMSIENIIGIKATEGPKFVASLEAHVLDYPVDVMKAQRVKNIEKKQLIEVELE
NGAVLKSKTVILSTGARYRQLGVKGEQEFKNKGVAYCPHCDGPLFKGKDVAVVGGGNSGV
EAAIDLAGIVNHVTLLQNTGELIADTVLQERLRSLPNVTIITNALTSEITGDRTVNGIEY
IDAVTKEKHHVALDGVFIQIGLLPNTEFLEGSVQLNERGEIVTDRNGATDIDGVFAAGDC
ANSAYKQIVISIGAGATAALSAFDYLIRHTEELVEV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttattagacgatcaaattaaaacacaactaaagcaataccttgccatgttagaagga
gacttagttttaaaagtacatgtgggcgaagatgaaacatcaaaaaatatgttagaactt
gttcaaacattagatgatatgtcaccacgtattacaattgaacatgcagaattagaacgt
acaccgagtttcagcgttaatcgtgtaggtgaagatacaggtgttatttttgcaggttta
ccacttggtcatgagttcacgtcgcttgtactggcgttattacaagtaagtggccgtgca
ccaaaaattgatgaatcaacagtaaaacgtattcaagcgattaaagagccaatgaacttt
gaaacatatgttagtttaacatgtcataactgtcctgacgttgtacaagcgttaaatatt
atgtctgtattaaatccaaatattacacatacaatgattgaaggcggcgctttcaaatca
gaagtagaagaaaaagaaatcatggctgtaccagcagtttaccgtgataaggatttcttt
gaaggtggtcgtatgacattagatgatattctagataaattaggttctacagttgatgct
gccgaattcaatgataaagaaccatttgacgtgttagtagtaggtggaggtccagcaggt
gcaagtgcagcagtttatgcagcacgtaaaggtgtgcgtacgggaattgttgcagaacgc
ttcggtggacaagtaaatgatacaatgtcgattgaaaatattatcggtataaaagcaaca
gaaggtccaaaatttgttgcaagtcttgaagcacatgtattagattatccagttgatgtg
atgaaagcacaacgtgtgaaaaatattgagaagaaacaattaatcgaagttgaattagaa
aatggtgcagttttaaaaagtaaaactgttattctatcaacaggtgctcgctaccgtcaa
ttaggcgtaaagggtgagcaagaatttaaaaataaaggtgtagcatattgtccacactgt
gatggcccattattcaaaggtaaagatgtagcagtagtaggcggcggtaactcaggtgtt
gaagcagcaatcgatttagctggaattgtgaaccatgtaacacttctacaaaacacaggt
gagttaattgcagatacagttctacaagaacgtttacgtagtttaccaaatgtaacaatt
atcacgaatgctttaacatctgaaattacaggtgatcgtacagtgaatggtattgaatat
atcgatgctgtaacgaaagaaaaacatcatgtagcacttgatggtgtattcattcaaatt
ggtttattaccaaatacagaattcctagaaggttctgttcaattgaatgaacgtggagag
attgttacagatcgtaatggagcaacagatatcgatggtgtgtttgcagcaggtgactgt
gcaaatagtgcctataaacaaatcgttatctcaattggtgcaggtgcaacagcggcattg
agtgcatttgattacctaattcgtcatacagaagagttagtagaagtataa

DBGET integrated database retrieval system