KEGG   Kurthia sp. 11kri321: ASO14_544Help
Entry
ASO14_544         CDS       T04250                                 

Gene name
serA
Definition
(GenBank) phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
kur  Kurthia sp. 11kri321
Pathway
kur00260  Glycine, serine and threonine metabolism
kur00270  Cysteine and methionine metabolism
kur00680  Methane metabolism
kur01100  Metabolic pathways
kur01120  Microbial metabolism in diverse environments
kur01130  Biosynthesis of antibiotics
kur01200  Carbon metabolism
kur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kur00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ASO14_544 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASO14_544 (serA)
   00270 Cysteine and methionine metabolism
    ASO14_544 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kur04147]
    ASO14_544 (serA)
Enzymes [BR:kur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     ASO14_544 (serA)
    1.1.1.399  2-oxoglutarate reductase
     ASO14_544 (serA)
Exosome [BR:kur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASO14_544 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT IlvN NAD_binding_2 AdoHcyase_NAD Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AMA61882
UniProt: A0A0X8CVR5
LinkDB All DBs
Position
complement(509348..510934)
Genome map
AA seq 528 aa AA seqDB search
MAINILISDPLSEDGIYPLRQEQELDLNIVSNTGLAPEELKAIIKDFDVLLVRSQTKVTR
EIIEAADNLKLIGRAGVGVDNIDLEAATEKGIIVVNAPDGNTNSAAEHTTAMIMALARHI
PHAYQSLMEGRWDRKKFVGVELKNKTLGVVGFGRIGQEVAHRAKGNRMNVIAYDPFLTAE
KAEKAGVDYGSVEDVAKVADFITVHTPLLDSTRHMINENIFNIMKDGVRIINCARGGIID
EEALYAAIESGKVAGAALDVMEEEPFVGNKLLDLPQVIATPHLGASTIEAQESVAVDVSN
DILSYFKHGTVLNPVNMPSVPKDMVAKVEPFFELGDKIGKLVSHLTDEPINEVNIYYSGD
LANFDVRPLTNNTVKGILTRNLGNHVNNVNARYLADRNDIKINEHKSTRAKAFLNSITVE
LVTNNTTHKVKGTLLAGLGARIVQIDDYNVDINPEGHILFIKHTDKPGAIGLVGTLLADQ
NINIATMQVGRAIEGGDAIMVLSVDHVVEYVDFLKQQKNIFEVKAITL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaatattttaattagcgatccactaagcgaagatgggatttaccctcttcgc
caagaacaagaattagatttaaatatcgttagtaatacaggtttagcacctgaagaacta
aaagcaatcatcaaagacttcgacgtactacttgttcgttctcaaacgaaagtaacgcgc
gaaattattgaagctgctgacaatttaaaattaattggtcgtgctggtgttggtgttgat
aatatcgacttagaagctgcaacagaaaaggggattatcgttgtcaacgctccagacggt
aatacaaactctgctgctgaacatacaacagcaatgattatggcactagctcgtcatatt
ccacatgcttaccaatctttaatggaaggtcgctgggatcgtaaaaaattcgttggtgtt
gaattaaagaataaaacacttggtgttgtcggttttggtcgtattggtcaagaagtggct
catcgcgcaaaaggtaaccgtatgaacgtcatcgcttatgacccattcttaacagctgaa
aaggcagaaaaagcgggtgttgattacggttctgtagaagatgtcgcaaaagtggctgac
ttcatcacagtccacacaccattacttgattctacacgtcatatgattaacgaaaatatt
tttaatattatgaaagatggcgtacgtatcatcaactgtgcacgcggtggaatcattgat
gaagaagctctttatgcagcaatcgagtctggtaaagtagctggcgcagcacttgacgta
atggaagaagaacctttcgtaggaaacaaattattagacttgcctcaagtcattgcaaca
cctcacttaggtgcttctacaattgaagcacaagagtcagttgcagtagatgtaagtaac
gatattttaagttacttcaaacatggtacagttttaaatcctgtgaacatgccatctgtt
cctaaagatatggtcgcaaaagtagaaccattcttcgaactaggcgataaaattggtaaa
ttagtttctcatttaacagacgaaccaattaacgaagtcaatatctattactctggtgat
ttagcaaacttcgatgttcgtccattaacgaataatacagtaaaaggaattttaacgcgt
aacttaggtaatcacgtaaataacgtaaacgcacgttacctagcggatcgtaatgatatt
aaaattaacgagcataaatcaacacgtgcaaaagcattcttaaactcaattacagttgag
ttagtaacaaacaatacaacgcataaagtaaaaggtacgctacttgctggacttggcgca
cgtattgtacaaattgatgactataatgtagatattaatccagaaggacatatcttattc
attaaacatacagataaaccaggtgcaatcggtttagttggtacactacttgcagatcaa
aatattaatatcgcaacgatgcaagttggacgtgcaattgaaggtggggatgccatcatg
gtactttcagttgaccacgtagttgaatatgttgacttcttaaaacaacaaaaaaatatt
ttcgaagtaaaagcaattacactataa

DBGET integrated database retrieval system