KEGG   Kurthia sp. 11kri321: ASO14_593Help
Entry
ASO14_593         CDS       T04250                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
kur  Kurthia sp. 11kri321
Pathway
kur00340  Histidine metabolism
kur01100  Metabolic pathways
kur01110  Biosynthesis of secondary metabolites
kur01230  Biosynthesis of amino acids
Module
kur_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ASO14_593 (hisE)
Enzymes [BR:kur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     ASO14_593 (hisE)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     ASO14_593 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AMA62035
UniProt: A0A109QDM6
LinkDB All DBs
Position
558747..559361
Genome map
AA seq 204 aa AA seqDB search
MKIQFGADGLVPVIIQHARTKEVLTLAYMNEESYKKTLETKETWLYSRSRQELWHKGATS
GHTQKVVAMRTDCDQDALVVEVLPNGPACHTGATSCFHEDVIEKSLAIGSLDILETLKNV
IQTREQEMPANAYTTYLFEQGVDKIGKKVGEEATEVVIAAKNRDAEELKWEAADLLYHLL
VLLQEQKLDLYDVLGVLQNRHEKH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaatttggagcagatggtttagtacctgtcatcattcaacatgcacgtaca
aaagaagtattaactttagcctatatgaacgaagaatcgtataaaaaaacactcgaaaca
aaagagacttggctgtactcgcgttcacgtcaagagctttggcataaaggagcgacaagt
ggacatacacaaaaagtcgtagcgatgcgtacggattgtgaccaagatgcgctcgttgta
gaagtattaccgaatggacctgcttgtcatacaggcgcaacatcttgcttccatgaagat
gtgattgaaaagtcacttgcgattggttcactcgatattttagaaacattgaagaatgtc
attcaaacgcgcgaacaagaaatgccagcgaatgcgtacacaacgtatttattcgaacaa
ggtgtcgataaaatcggtaaaaaagtgggcgaagaagcaacagaggttgtcatcgctgcg
aagaatcgtgatgcagaagaattgaagtgggaagcagccgacttgttgtatcacttactc
gtcttattacaagagcaaaaattagatttatatgatgtattaggcgtcttacaaaatcgt
catgaaaaacattaa

DBGET integrated database retrieval system