KEGG   Kushneria konosiri: B9G99_10290Help
Entry
B9G99_10290       CDS       T04839                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
kus  Kushneria konosiri
Pathway
kus00040  Pentose and glucuronate interconversions
kus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B9G99_10290
Enzymes [BR:kus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     B9G99_10290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Cupin_2
Motif
Other DBs
NCBI-ProteinID: ARS53197
UniProt: A0A2Z2HDB0
LinkDB All DBs
Position
2226998..2228053
Genome map
AA seq 351 aa AA seqDB search
MKARALVLERQNELALREIELPDEVGPDEVRISMHTVGICGSDIHYYTHGRIGPFVVEAP
MVLGHEGAGTVTEVGANVTTLSPGDRVCMEPGIPDPTSRASKLGMYNVDPAVRFWATPPV
HGCLTPEVIHPAAFTFKLPDSVSFAEGAMVEPFAVGMQAVVKAKLQPGDTCVVTGCGPIG
LMVALAALASGASRVVISDVVDDKLDIAAGYEGLIPVNVARESLTERVAELAGEGWGADV
VFEASGSARVYDDALACVRPGGAMVLVGMPVEKVSLDVVLAQTKEVRIETVFRYANVYDR
AIELIASGKVDLKPLIVETFDFEQSVAAFDRAVEARPTDVKLQIRVADDRH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaagggcactggtacttgagcgtcaaaacgagctggccctgcgtgagatcgaa
ctgcccgatgaggtcggcccggacgaggtgcgcatcagcatgcacaccgtgggcatctgc
ggcagcgatattcactattacacccacgggcgcattggtccctttgtggttgaagcgccc
atggtgctgggtcacgagggtgccgggaccgtcaccgaagttggcgccaatgtgaccacg
ctctcccctggtgaccgggtctgcatggagcctggcattcccgatccgacatcacgcgcc
tcgaagcttgggatgtacaacgtcgatccggccgtgcgcttctgggccacgccaccggta
catggctgtctcacgcccgaggtcatccatccggcggcctttaccttcaagctgccggac
agtgtctcctttgccgaaggcgccatggtcgagccgtttgcagtgggcatgcaggcggtg
gtcaaggcgaagcttcagccaggagatacctgcgtggtgaccggctgtggtccgatcgga
ctgatggtggcgctggcagcgctcgcatcgggcgccagccgggtggtgatttctgatgtg
gtcgacgacaagctcgatatcgcggctggctatgaggggctgattcctgtcaacgtcgcg
cgcgagtcgctgaccgagcgcgtggctgaacttgccggtgagggctggggcgccgatgtg
gtgttcgaggccagcggcagtgcgcgggtgtatgacgatgcgctggcctgcgtgcgcccg
ggtggcgccatggtgctggtcggcatgccggtcgagaaggtcagtctcgatgtggtgctc
gcccagacgaaggaagtccgcatcgagaccgtgtttcgctatgccaacgtctacgaccgt
gccatcgagctgatcgcctccggcaaggtggatctcaagccgttgatcgttgaaaccttt
gacttcgaacagagcgtggcggcctttgatcgcgccgttgaggcacgccctaccgacgtc
aaactgcagatcagggtcgccgacgaccgacactga

DBGET integrated database retrieval system