KEGG   Klebsiella variicola At-22: Kvar_0309Help
Entry
Kvar_0309         CDS       T01170                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00564  Glycerophospholipid metabolism
kva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Kvar_0309
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Kvar_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ADC56240
LinkDB All DBs
Position
complement(342351..343859)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISESLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLNAE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gatgccgccgggcggggtttatccgtactgatgctggaagcgcgcgatctcgcctgcgct
acctccagcgccagttccaaacttatccacggcgggctacgctacctcgaacactatgag
ttccgcctggtcagcgaagcgctggccgagcgtgaagtgctgttaaaaatggctccgcat
atcgccttcccgatgcgctttcgtctcccgcatcgtccgcatctgcgtccggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctgccgggctcc
accggcttgcgttttggcgcagaatcggtacttaagccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggttgtc
cgcaaaggcggcgaagtgcggacccgcactcgcgccatctcggcaaaacgagagaatggc
ctgtgggtggtggaagcggaagatatcgatagcggcgagaagtttacctggaaggcgcgc
ggtctggtcaatgccaccggtccatgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccttacggtatccgcctgatcaagggcagccacatcgtggtgccgcgagtgcat
actcagaagcaggcctatattctgcaaaacgaagataaacgtattgtgtttgttatcccg
tggatggatgagttctccatcatcggcacgacggacgtcgagtataagggcgatccgaaa
gcggtagccattgatgataaagagattaattacctgctgaacgtctataacgcgcacttt
aaaaagactctcagccgggacgatatcgtctggacctactccggcgtccgtccgctgtgt
gatgacgagtcggattcgccgcaggcgatcacccgcgactacacgctggatattcacgat
gagaacggccaggcgccgctgctctccgtcttcggcgggaagctgaccacctatcgcaag
ctggccgagcatgcgctggaaaaactgactccctattacaaagggatcggcccggcatgg
accaaaaccgcggtgctccccggcggcgatatcggcggcgaccgcgacgactatgcagca
aaactacgccgtcgcttcccgttcatcagcgaatcactggcccgccattatgcccgcacc
tacgggagcaacagcgagtggatcctgaaggaagccagcgccctgagcgatctgggggaa
gatttcggccatgagttttatgaagccgagctgaaatatctggttgagcacgaatgggtg
cgcagcctggatgacgccatctggcgtcgtaccaaacagggcatgtggctgaatgccgag
cagcaagcgcgcatcagcgaatggctggcgcagcatgcgggaaagtctgaactgtcgtta
gcgtcctga

DBGET integrated database retrieval system