KEGG   Klebsiella variicola At-22: Kvar_0546
Entry
Kvar_0546         CDS       T01170                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00052  Galactose metabolism
kva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Kvar_0546
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     Kvar_0546
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Methyltransf_25 2-Hacid_dh_C 3HCDH_N MTS UDPG_MGDP_dh_N ELFV_dehydrog Methyltransf_31 PrmA Methyltransf_11 Pyr_redox_2 FAD_binding_2 CoA_binding Methyltransf_24 Shikimate_DH Pyr_redox Met_10 Peptidase_U32
Other DBs
NCBI-ProteinID: ADC56476
LinkDB
Position
complement(572515..573558)
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKALGATRVFNSREMSGQAIQQALEAIQFDQLVLETAGTP
QTVTLAIEAAGPRAQLALVGTLHHDLTLPAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatccct
acgctgcaaacggaaaacgatgtcctggtcaaagtggtcagttccggattatgcggctcc
gacatcccgcgcattttcgccaaaggcgcgcattactaccctattacgctggggcacgaa
ttcagcggctatgtggaatcctacggcgcggcggtaactgatctgcagcccggcgatgcc
gtcgcctgcgtgccactgctgccctgctttcagtgtccgcagtgccagcgcgagtatttc
tctttatgtaaacaatatcagtttgtcggctcacgcagcgaaggtggcaacgccgaatat
gtggtggtgaagcgcgccaacctgttccgcctgccggatcagatgccgattgatgacggc
gcgtttatcgagccgataaccgttggcctccacgccttccacctggcgcagggttgcgaa
ggtaaaaacgtgattattatcggtgcgggcaccattggcctgctggcattacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatcctcagaaactggagctg
gccaaagcccttggcgcaacccgagtgttcaacagccgcgaaatgagcggccaggcgatt
cagcaggcgctggaagccattcagttcgaccagttagtccttgagaccgccggcacgccg
cagaccgtcacgctggcgattgaggccgccggtccgcgggcgcagttggcgctggtcggc
acgcttcatcacgatttaaccctcccggccgccaccttcgggcagatcctgcgtaaagag
ttgaatattgtcggtagctggatgaattactctggtccgtggccaggagaagagtggcaa
acggccacccgcctgctgacagaaaaacgcctgcagctggcaccgctaatagcccaccgc
ggtgacgcggagagctttgcgcgtgaagttcaggcgctaaacggcgcaccgatgcagggt
aaaatcctgctcaaactctcctga

DBGET integrated database retrieval system