KEGG   Klebsiella variicola At-22: Kvar_4132Help
Entry
Kvar_4132         CDS       T01170                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00250  Alanine, aspartate and glutamate metabolism
kva00280  Valine, leucine and isoleucine degradation
kva00410  beta-Alanine metabolism
kva00640  Propanoate metabolism
kva00650  Butanoate metabolism
kva01100  Metabolic pathways
kva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Kvar_4132
   00650 Butanoate metabolism
    Kvar_4132
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Kvar_4132
   00280 Valine, leucine and isoleucine degradation
    Kvar_4132
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Kvar_4132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kva01007]
    Kvar_4132
Enzymes [BR:kva01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Kvar_4132
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Kvar_4132
Amino acid related enzymes [BR:kva01007]
 Aminotransferase (transaminase)
  Class III
   Kvar_4132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADC60009
LinkDB All DBs
Position
4351032..4352315
Genome map
AA seq 427 aa AA seqDB search
MNSNKAMMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
QVVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAEDHPEIGDVRGLGAMIAIELF
EEGDRSKPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADC
FTEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagcaatgatggcgcgtcgcagcgatgcggtcccgcgcggcgtcggc
cagatccaccctatcttcgccgaacgcgcggagaactgccgggtgtgggacgtcgaaggc
cgggaatatctcgattttgccggcggtatcgcggtgctcaataccggccatctgcatccg
caggttgtcgccgccgtcgaagaccagctgaaaaagctgtcgcatacctgctttcaggta
ctggcctacgagccttacctggcgctgtgcgaaaagatgaaccagaaggtgcccggtgat
ttcgccaagaaaaccctgctggtcaccaccgggtcggaagcggtggagaacgcggtgaaa
atcgcccgcgcggcaaccgggcgcagcggcgccatcgccttcaccggcgcttatcacggc
cgtacccattataccctgtcgctgaccggaaaagtgaacccgtactccgccggtatgggg
ttaatgccgggccacgtctatcgcgccctctacccgtgcgcgctgcacggcgtcagtgat
gacgaggcgatcgccagcatccatcgcatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcattattgagccggtgcagggtgaaggcgggttttatgccgcttccccggct
tttatgcagcgcctgcgcgccctgtgcgacgaacacggcattatgctcatcgccgatgag
gtccagagcggcgcgggccgtaccggcacgctgttcgccatggagcagatgggcgtggcg
gcagatatcaccaccttcgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
gggcgggcggaggtgatggatgccatcgcccccggcggactcggcggcacctacgctggc
aaccccatcgcctgcgccgccgccctggcggtattacagattttcgagcaggagaacctg
ctggaaaaagccaaccagcttggcgacaccctgcgccagggcctgctggcgattgcagaa
gatcatccggagatcggtgacgttcgcggcctgggggcgatgatcgccattgagctgttt
gaagagggcgaccgcagcaagcctaacgccaggctgacggcggatatcgtcgcccgcgcc
cgcgacaaaggcctgatcctgctctcctgcgggccgtactacaacgtgctgcgcatcctg
gtgccgctgaccattgaagaggcgcagatcgagcagggtctcaagatcatcgccgactgc
tttaccgaggcgaaacaggcatag

DBGET integrated database retrieval system