KEGG   Klebsiella variicola DX120E: KR75_05285
Entry
KR75_05285        CDS       T03531                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00052  Galactose metabolism
kvd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KR75_05285
Enzymes [BR:kvd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     KR75_05285
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Methyltransf_25 2-Hacid_dh_C MTS Methyltransf_31 UDPG_MGDP_dh_N ELFV_dehydrog 3HCDH_N FAD_binding_2 PrmA Methyltransf_11 Methyltransf_24 CoA_binding Pyr_redox_2 Shikimate_DH Pyr_redox Met_10 Peptidase_U32 Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AJA94266
LinkDB
Position
complement(580577..581620)
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQKENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKALGATRVFNSREMSGQAIQQALEAMQFDQLVLETAGTP
QTVTLAIEAAGPRAQLALVGTLHHDLTLPAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatccct
acgctgcaaaaggaaaacgatgtcctggtcaaagtggtcagttccggattatgcggctcc
gacatcccgcgcattttcgccaaaggcgcgcattactaccctattacgctggggcacgaa
ttcagcggctatgtggaatcctacggcgcggcggtaaccgatctgcagcccggcgatgcc
gtcgcctgcgtgccactgctgccctgctttcagtgtccgcagtgccagcgcgagtatttc
tctttatgtaaacaatatcagtttgtcggctcacgcagcgaaggtggcaacgccgaatat
gtggtggtgaagcgcgccaacctgttccgcctgccggatcagatgccgattgatgacggc
gcgtttatcgagccgataaccgttggcctccacgccttccacctggcgcagggttgcgaa
ggtaaaaacgtgattattatcggtgcgggcaccattggcctgctggcattacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaaactggagctg
gccaaagcccttggcgcgacccgagtgttcaacagccgcgaaatgagcggccaggcgatt
cagcaggcgctggaagccatgcagttcgaccagttagtccttgagaccgccggcacgccg
cagaccgtcacgctggcgattgaggccgccggtccgcgggcgcagttggcgctggtcggc
acgcttcatcacgatttaaccctcccggccgccaccttcgggcagatcctgcgtaaagag
ttgaatattgtcggtagctggatgaattactctggtccgtggccaggagaagagtggcaa
acggccacccgcctgctgacagaaaaacgcctgcagctggcaccgctaatagcccaccgc
ggtgacgcggagagctttgcgcgtgaagttcaggcgctaaacggcgcaccgatgcagggt
aaaatcctgctcaaactctcctga

DBGET integrated database retrieval system