KEGG   Klebsiella variicola DX120E: KR75_06170Help
Entry
KR75_06170        CDS       T03531                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
kvd  Klebsiella variicola DX120E
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kvd03012]
    KR75_06170
   03029 Mitochondrial biogenesis [BR:kvd03029]
    KR75_06170
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kvd04147]
    KR75_06170
Translation factors [BR:kvd03012]
 Eukaryotic Type
  Elongation factors
   KR75_06170
 Prokaryotic Type
   KR75_06170
Mitochondrial biogenesis [BR:kvd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KR75_06170
Exosome [BR:kvd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KR75_06170
  Exosomal proteins of breast cancer cells
   KR75_06170
  Exosomal proteins of colorectal cancer cells
   KR75_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AJA94431
UniProt: A0A0B7GDC0
LinkDB All DBs
Position
423215..424399
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgttggtactatcggccac
gttgaccatggtaaaactaccctgactgctgccatcactaccgttctggctaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcaccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgaactgctgtctcag
tacgatttcccgggcgacgacaccccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggccacctggatacctatatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtcggt
gaagaagttgaaatcgttggtatcaaagacaccgcgaaaaccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcagcatcaag
ccgcacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggttatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgtagctaaagttctgggctaa

DBGET integrated database retrieval system