KEGG   Klebsiella variicola DX120E: KR75_06515Help
Entry
KR75_06515        CDS       T03531                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00564  Glycerophospholipid metabolism
kvd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KR75_06515
Enzymes [BR:kvd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KR75_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AJA94498
LinkDB All DBs
Position
complement(350414..351922)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISESLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLNAK
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gatgccgccgggcggggtttatccgtactgatgctggaagcgcgcgatctcgcctgcgct
acctccagcgccagttccaaacttatccacggcgggctacgctacctcgaacactatgag
ttccgcctggtcagcgaagcgctggccgagcgtgaagtgctgttaaaaatggctccgcat
atcgccttcccgatgcgctttcgtctcccgcatcgtccgcatctgcgtccggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctgccgggctcc
accggcttgcgttttggcgcagaatcggtacttaagccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggttgtc
cgcaaaggcggcgaagtgcggacccgcactcgcgccatctcggcaaaacgagagaacggc
ctgtgggtggtggaagcggaagatatcgatagcggcgagaagtttacctggaaggcgcgc
ggtctggtcaatgccaccggtccatgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccttacggtatccgcctgatcaagggcagccacatcgtggtgccgcgagtgcat
actcagaagcaggcctacattctgcaaaacgaagataaacgtattgtgtttgttatcccg
tggatggatgagttctccatcatcggcacgacggacgtcgagtataagggcgatccgaaa
gcggtagccattgatgataaagagattaattacctgctgaacgtctataacgcgcacttt
aaaaagactctcagccgggacgatatcgtctggacctactccggcgtccgtccgctgtgt
gatgacgagtcggattcgccgcaggcgatcacccgcgactacacgctggatattcacgat
gagaacggccaggcgccgctgctctccgtcttcggcgggaagctgaccacctatcgcaaa
ctggccgagcatgcgctggaaaaactgactccctattacaaagggatcggcccggcatgg
accaaaaccgcggtgctccccggcggcgatatcggcggcgaccgcgacgactatgcagca
aaactgcgccgtcgcttcccgttcatcagcgaatcactggcccgccattatgcccgcacc
tacgggagcaacagcgagtggatcctgaaggaagccagcgccctgagcgatctgggggaa
gatttcggccatgagttttatgaagccgagctgaaatatctggttgagcacgaatgggtg
cgcagcctggatgacgccatctggcgtcgtaccaaacagggcatgtggctgaatgccaag
cagcaagcgcgcatcagcgaatggctggcgcagcatgcgggaaagtctgaactgtcgtta
gcgtcctga

DBGET integrated database retrieval system