KEGG   Klebsiella variicola DX120E: KR75_06725Help
Entry
KR75_06725        CDS       T03531                                 

Definition
(GenBank) hypothetical protein
Organism
kvd  Klebsiella variicola DX120E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2500
Motif
Other DBs
NCBI-ProteinID: AJA94539
UniProt: A0A0B7GAP5
LinkDB All DBs
Structure
PDB: 

Position
305518..305877
Genome map
AA seq 119 aa AA seqDB search
MSKMPLFFVLVVAVIVVAASFRYVQQRREKQANDAAPLLQKRVIVSNKREKVINDRRSRQ
QTVTPAGSEMRYEASFRPENGGLEVVFRLDAPQYHALSVGDRGMLSYKGTAFVAFTPDP
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatgcccctcttttttgttctggtcgtcgcggtgattgtggtggcggcttcg
tttcgctatgtccagcagcgccgtgagaaacaggcgaatgacgccgcgccgttgctacaa
aagcgggttatcgtcagcaataaacgggaaaaagtgattaacgatcggcgctcgcggcag
cagacggtgacgcccgcaggcagtgagatgcgctatgaagcgagctttcgccccgaaaac
ggtgggctggaggtggtgtttcgcctcgacgcgccgcaatatcatgcgctgagcgtgggc
gatcgcgggatgttgagttataagggcacagcgttcgtggcgtttacgcccgatccctga

DBGET integrated database retrieval system