KEGG   Klebsiella variicola DX120E: KR75_09235Help
Entry
KR75_09235        CDS       T03531                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00071  Fatty acid degradation
kvd00280  Valine, leucine and isoleucine degradation
kvd00281  Geraniol degradation
kvd00310  Lysine degradation
kvd00362  Benzoate degradation
kvd00380  Tryptophan metabolism
kvd00410  beta-Alanine metabolism
kvd00640  Propanoate metabolism
kvd00650  Butanoate metabolism
kvd00903  Limonene and pinene degradation
kvd00930  Caprolactam degradation
kvd01100  Metabolic pathways
kvd01110  Biosynthesis of secondary metabolites
kvd01120  Microbial metabolism in diverse environments
kvd01130  Biosynthesis of antibiotics
kvd01200  Carbon metabolism
kvd01212  Fatty acid metabolism
Module
kvd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KR75_09235
   00650 Butanoate metabolism
    KR75_09235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KR75_09235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KR75_09235
   00310 Lysine degradation
    KR75_09235
   00380 Tryptophan metabolism
    KR75_09235
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KR75_09235
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KR75_09235
   00281 Geraniol degradation
    KR75_09235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KR75_09235
   00930 Caprolactam degradation
    KR75_09235
Enzymes [BR:kvd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KR75_09235
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KR75_09235
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KR75_09235
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     KR75_09235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJA95016
UniProt: A0A4S4HFS3
LinkDB All DBs
Position
5258832..5261021
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQNDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALK
IGLVDGVVAAEKLRDGALAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETEAKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDKTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLADVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggttcggtcaacaagcttgataccgcaaccgtagccagcctcggt
cacgcgctggacgtactggaaaaacaaaacgatctcaaaggtctgctgctgcgctctgaa
aaagcggcgtttatcgtcggcgcggatatcaccgaattcctctcgctgttcctggtccct
gaggagcagttaagccagtggttgcattttgctaacagcgttttcaatcgtctggaagat
cttcccgtcccgacgatctctgccgtcaatggttacgcgctgggcggcggttgtgaatgc
gtcctggcgaccgattaccgcctggcgacgccggatctgcgtatcggtctgccggaaacc
aagctcggcattatgccgggcttcggcggttctgtgcgtctgccacgcttgctcggcgcc
gatagcgcgctggaaattattgccgccgggaaagacgtcggcgccgatcaggcgctgaaa
atcggcctggtggatggtgtggtcgcagcggaaaaactgcgtgacggcgcgctggcgatc
ctgcgtcaggcgattaatggcgatctggactggaaagcaaaacgtcagccgaaactagag
ccgctgaagctcagcaaaattgaagctaccatgagcttcacgattgccaaaggcatggtc
gcgcaaacggccgggaaacattacccggcgccgatcaccgcggtgaaaaccattgaagcc
gccgcacgtcttggtcgtgaagaagccctggtgctggaaaataaaagctttgtcccgctg
gcccataccaatgaggcccgcgcgctggttggtatcttcctgaacgaccagtacgtcaaa
gcgaaagcgaaaaagttgaccaaagatgtcgagacgccgaagcatgctgctgtcctgggc
gctggcattatgggcggcggtatcgcataccagtcggcctggaaaggcgtgccggtggtg
atgaaagacattagcgacaaatcgctgaccctgggcatgaccgaagcggcgaaactgctg
aataaacagctggaacgcggcaaaatcgacggtctgaagctggccggagtgatcagcacc
attcagccaaccctggaatacagcggttttgatcgcgtcgacgtggttgttgaagcggtg
gtcgaaaacccgaaagtgaagaaagcggtgctggccgaaaccgaggcaaaagtgcgcccg
gataccgtgctggcatccaacacctcaacaatccccatcagcgaactggccagcgttctg
caacgcccggaaaacttctgcggtatgcacttctttaacccggtgcatcgcatgccgctg
gttgaagtgatccgcggcgaaaaaacctcggataagaccattgccaaagttgtggcctgg
gccagcaaaatgggcaagacgccaatcgtggtgaatgattgtcccggcttcttcgtcaac
cgcgtgctgttcccctacttcgccggcttcagccagctgctgcgcgacggggcggatttc
cgcaaggtcgacaaagtgatggaaaaacagtttggctggccaatgggcccggcctatctg
ctggatgttgtcggcatcgataccgcccaccatgctcaggccgtgatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccatcgacgccctgtttgacgccaaccgt
ttcggccagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgctgccgtcgacagcctgctggccgacgtcagccagccgaagcgc
gatttcagcgatgaagagattatcgcccgcatgatgatcccgatggttaacgaagtcgtc
cgctgcctggaagaaggcattatcgccagcccggcggaagcggatatggcgctggtatac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggacaccatcggcagc
gcgaagtatctcgatatggcacagcaataccagcaccttggcccgctgtatgaagtgcca
gccggtctgcgtgacaaagcgcgccataacgaagcgtattatccccaggtagagccagcc
cgtccggttggcgctctgaaaacggcttaa

DBGET integrated database retrieval system