KEGG   Klebsiella variicola DX120E: KR75_10570Help
Entry
KR75_10570        CDS       T03531                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KR75_10570
Enzymes [BR:kvd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KR75_10570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_35 Glyco_hydro_2_C Cellulase DUF4434 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: AJA95266
LinkDB All DBs
Position
4975859..4977868
Genome map
AA seq 669 aa AA seqDB search
MSHLFYGVAYYDEYMPEDRLAKDIALMRETGINVVRIAESTWSTLEPEEGQYNFYHIDRV
LEAMHEAGIAVIVGTPTYAVPAWLAAKHPDILVTTVAGQQKYGPRQIMDIVNPTFRRYAE
KIIRTLMAHVQHHPAIIGWQLDNETKHYDNIGRYMQEGFVRSLQEKYPDLRQLNHDFGLD
YWSNRIDRWQDFPPVENTINASLACAFSRYQRQQVTEYLAWQAAIVREYAQPHQFVTHNF
DFEWRGYSYGVQPRVDHFAAAQALDIAGVDIYHPSQAHLTGREIAFGGAITRSLKPGQNY
FVLETQAQGFAQWTPFPGQLRLQAFSHIASGAAMVSYWHWHSIHNAFETYWKGLLSHDFS
RNPTWQEATTIGADFARLSPQLAELKVENDVALLISNEAMDALNHFRPGDAEGNIYNDIF
RRFHDALYDHNISLDIIHDVNEETSRYRVLIVPGLYAADDGLLTRINDYIARGGRALIGF
KSGFSDENVKVRNSAQPGILRQSCGVSYSQFTLPEGTTVSSCCAEIDCRNDNQAELWMEL
LTPDGGTRTLLRYQHPAWGEYAAATAADYGQGRALYVGFLPHKRLISQLFDVLTADLTLN
SRTSAYRYPLVVKKMSNRAGNTIHFLFNYSGEALDVVSETAGTALLSGEAVDVGQPLRLR
AWEFTIIES
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatttattttatggcgtagcgtattacgatgaatatatgccggaagatcggctg
gcgaaggatatcgccttaatgcgcgaaaccggcattaacgtggtgcgtattgccgagtcc
acctggagtacgctggagcctgaagagggccagtacaatttctaccatatcgaccgggtg
ctggaggcgatgcatgaggccggcattgcggtcatcgtcgggacgccgacctacgccgta
ccggcctggctggcggcgaaacatcccgatattctggtcaccaccgtcgcggggcagcaa
aaatatggcccgcggcagatcatggatatcgtcaatccgacctttcgccgctatgccgaa
aaaattatccgcacgctgatggcccatgtgcaacatcatccggcgattatcggctggcaa
ctggataacgaaaccaagcattacgacaatattggccgctatatgcaggagggcttcgtg
cgcagcctgcaggagaaatatcctgacctccggcagctgaatcacgatttcggtctggat
tactggagcaaccgcattgaccgctggcaggattttccgccggtggaaaacaccatcaac
gccagcctcgcctgcgccttctcccgctatcagcgtcagcaggtcaccgagtatctggcc
tggcaggcggccatcgttcgggaatacgcccagccgcaccagttcgtcacccacaacttc
gatttcgaatggcgcggttactcttacggcgtgcagccgcgggtcgaccattttgcggcg
gcgcaggcgctggatatcgccggtgtcgatatctatcacccgagtcaggcgcacctgacc
gggcgggaaatcgcctttggcggcgccatcacccgctcgcttaagccgggccagaactac
ttcgtgctggaaacccaggcacagggcttcgcccagtggacccccttcccgggccagcta
cgcctgcaggcattcagccatatcgcctccggcgccgccatggtctcctactggcactgg
cattcgattcataacgccttcgaaacctactggaaggggctgctcagccacgacttctcg
cgcaacccaacctggcaggaagccaccaccatcggcgccgatttcgcccgcctgtcgccg
cagttggcggagctgaaggtcgaaaatgacgtcgcgttgctaataagcaatgaggcgatg
gacgccctcaatcacttccgtcccggcgatgccgagggcaacatttataacgatatcttc
cgccgcttccacgatgcgctgtatgaccacaatatcagcctcgacatcatccacgatgtg
aacgaggaaacctcgcgctaccgggtactgatcgttcctggtctgtacgccgccgatgat
ggcctgctaacgcggattaacgactatatcgcccggggcggcagagcgctgatcggcttt
aaatcaggctttagcgatgaaaatgtcaaggtgcgcaacagcgcgcagccggggattttg
cgccagagctgcggcgtcagctacagccagttcaccctgccggaagggacgacggtaagc
tcatgctgcgcagagattgattgccgcaatgataatcaggctgagctgtggatggaattg
ctgacgcccgatggcggaacccgcacactgctgcgctatcagcatccggcatggggcgaa
tacgccgccgcaacggcggcggattacggtcagggacgcgccctgtacgttggcttcctg
ccgcacaagcgcctgattagccagctgtttgatgtcctgacggcggatctcacgctgaac
tcgcgaacttccgcctatcgctatccgttagtggttaaaaagatgagtaaccgagccgga
aatactatccacttcctgttcaattactccggcgaggcgctggatgttgtcagcgagacc
gcgggtaccgcgctgctgagcggggaggctgtagacgtcggccagccgttgcgcctcagg
gcctgggaatttactatcatcgaaagctaa

DBGET integrated database retrieval system