KEGG   Klebsiella variicola DX120E: KR75_12760Help
Entry
KR75_12760        CDS       T03531                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00061  Fatty acid biosynthesis
kvd00780  Biotin metabolism
kvd01100  Metabolic pathways
kvd01212  Fatty acid metabolism
Module
kvd_M00083  Fatty acid biosynthesis, elongation
kvd_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KR75_12760
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KR75_12760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kvd01004]
    KR75_12760
Enzymes [BR:kvd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KR75_12760
Lipid biosynthesis proteins [BR:kvd01004]
 Fatty acid synthase
  Component type
   KR75_12760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AJA95685
UniProt: A0A087FUM9
LinkDB All DBs
Position
complement(4491623..4492078)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcacattgaagagattctggaacttctgcctcaccgt
tacccgttcctgctggtagaccgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtttctgtaaacgagccgtttttccaggggcacttccctggtaagccgatt
ttgcctggcgtgctgattctggaagcgatggcgcaggccaccgggattctggcatttaaa
agcgtcggaaaactggagccaggcgagctgtattatttcgcaggcatcgacgaagcgcgc
ttcaaacgtccggtagtaccaggcgatcagatgattatggaagtcactttcgagaaaacc
cgccgcggcctgacccgtttcaaaggcgtcgcgctggttgacggtaaagtggtttgcgaa
gcgacgatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system