KEGG   Klebsiella variicola DX120E: KR75_13455Help
Entry
KR75_13455        CDS       T03531                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00730  Thiamine metabolism
kvd00790  Folate biosynthesis
kvd01100  Metabolic pathways
kvd02020  Two-component system
Module
kvd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KR75_13455
   00790 Folate biosynthesis
    KR75_13455
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KR75_13455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kvd04147]
    KR75_13455
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kvd00537]
    KR75_13455
Enzymes [BR:kvd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KR75_13455
Exosome [BR:kvd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KR75_13455
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kvd00537]
 Enzymes
  KR75_13455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest PT-VENN
Motif
Other DBs
NCBI-ProteinID: AJA95811
UniProt: A0A288TWP3
LinkDB All DBs
Position
complement(4351741..4353156)
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALVPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEALRASLI
NKPAKNVILLIGDGMGDSEITAARNYAQGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAETATAG
EWQGKTLREQAEARGYQIVTDAASLAAATDASQAKPLLGLFADGNMPVRWEGPKASYHGN
IDKAPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTHDGAVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFSTMKAALSLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgccctgtttattgccctggttcctctgctgggctcgccggttattcat
gcagaaacgactgctgcgccggttctggaaaatcgcgctgcgcagggagatatcaccact
cccggcggcgcgcgtcgtttaaccggcgatcaaaccgaagcgctgcgcgcctcgttaatc
aataagccggctaaaaacgttattttgctgattggcgatggcatgggtgattcggaaatt
accgctgcgcgaaattatgcgcaaggggcgggcggtttctttaaagggattgacgccttg
ccgttaaccgggcagtacacgcactattcgctggataaaaaaaccgggaaaccggactac
gtgaccgactcggcggcgtccgccactgcctggaccaccggcgtcaagacctataacggc
gcgctgggcgtcgatattcatgagaacgcgcatcagaccatcctcgagctggcgaaagcg
gcggggctggccaccggcaacgtttccaccgccgagctgcaggacgccacccccgcagcg
ctggtggcgcatgtgacatcgcgtaaatgttacggccccacggtcaccagtgaaaaatgc
cccagcaatgcgctggagaaagggggcaaaggctccattaccgaacagctgctgaacgcc
cggccggatgtcaccttaggcggcggggcgaagacctttgccgaaacggcgacggcgggc
gagtggcagggcaaaaccctgcgcgagcaggcggaagcgcgcggctaccagattgtgacc
gacgcggcttcccttgccgccgcgactgacgccagtcaggctaagccgctgctgggactc
ttcgccgatggcaatatgccggttcgctgggaagggccgaaggcgtcttatcacggcaat
atcgataaggcgccggtgacctgtacgccaaacccgaaacgcgacgcctcggtgccgacg
ctggcgcagatgacggagaaagcgattgacctgctgagccgcaacgagaaaggtttcttc
ctgcaggtggaaggcgcttccatcgataaacaggatcatgcggcgaatccgtgtggccag
atcggcgaaaccgtagacctcgacgaagcggtgcagaaggcgctggagtttgcgcgaaaa
gacggcaataccctggtgatcgtcaccgccgaccatgcgcacgccagccagatcattccg
gcggacagcaaagccccgggactgacccaggctctgaatacccacgatggcgcagtgatg
gtcatgagctacggcaactctgaggaagagtcgatggagcataccggcacccagctgcgc
attgcggcctacggtccacacgcggctaacgtcgtcggcctgaccgaccagaccgacctg
ttctcgaccatgaaagccgccctgagtctgaaataa

DBGET integrated database retrieval system