KEGG   Klebsiella variicola DX120E: KR75_13985Help
Entry
KR75_13985        CDS       T03531                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kvd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KR75_13985
Enzymes [BR:kvd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KR75_13985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AJA95915
LinkDB All DBs
Position
complement(4243606..4245663)
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDLDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDTILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLKINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEVSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWQLAKALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVSQLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYRLVIAPMLYMVRDGFAARAE
AFVASGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHTESAQTLATYRDDFYAGRPAVTVNGFGKGKAWHVASRNDLA
FQRDFFAALSRELDLPRAIAADLPPGVVATARTDGESTFVFLQNYSAQSHTLTLPPGYWD
CLTDAAVSDPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgacctcgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccgcgc
gaaggggtatttaacttcgcctggctggatactatcctcgataaactgtatgccgccggc
attcatgtttttctggccacgccgagcggcgcgcgtccggcgtggatgtctcagcgctat
ccgcaggttctgcgggtgggacgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctgaaaatcaataccctgcttgca
gagcgttattcttcacacccggcggtactgggctggcatatttccaatgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctataccgac
tggtcgcaaattgaatcacctgcgccacagggcgaggtgtcaattcacggtctcaatctt
gactggcatcgctttaacaccgctcaggtgaccgatttctgccgccatgaaattgccccg
ctgaaggcggctaacgcctccctgccggtgaccactaactttatggagtatttctacgat
tacgactactggcaactggcaaaggcactggactttatctcgtgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcactggcctgctacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccacaccaggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctctcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcggtggttgaccacgtcgggcacattgatacccgtattggt
cgtgaagtcagccagctcggcgagatactgagcaagctaccggaggtccggggttgtcgc
accgaggcgaaagtagcgattatcttcgaccaacaaaaccgctgggcgcttgatgacgcc
caggggccgcgcaatctgggtatggagtatgagaagacggtcaacgaacactaccgtccg
ttctgggaacagggcattgccgtcgatgtgattgacgctgatgtcgatttaacgccatac
cggttagtgattgccccgatgttatatatggtgcgcgacggttttgccgcgcgggcagag
gcgtttgtcgccagcggcggccacctggtgaccacctactggaccggcatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctggggatctgg
gcggaagagatcgactgtctgaatgacggcgagtttaatcttgtgcaggggcttgccggg
aatcagtgcggtctgcaggggccctatcaggtgcgccatctctgtgaactaatccatacc
gagagcgctcagacgctagccacctaccgggatgatttctatgccggacggccggcggtg
acggtgaacggtttcgggaaaggtaaagcctggcatgtcgcctcccgcaacgatttagcc
ttccagcgcgatttctttgctgccctgagcagggagctggatctgccacgagcgatagcg
gcggatttaccgcccggcgtagtggctaccgcgcgcaccgacggtgagagcacgtttgtc
ttcctgcagaactacagcgcgcaaagtcatactctgactctgccgccggggtattgggat
tgcctgaccgacgcggcggtgtcagacccgctgacactctcagcatgggattgccgtatt
cttcgtcgccacgcgtaa

DBGET integrated database retrieval system