KEGG   Klebsiella variicola DX120E: KR75_16320Help
Entry
KR75_16320        CDS       T03531                                 

Definition
(GenBank) peptidase M15
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00550  Peptidoglycan biosynthesis
kvd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KR75_16320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kvd01002]
    KR75_16320
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kvd01011]
    KR75_16320
Enzymes [BR:kvd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KR75_16320
Peptidases [BR:kvd01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   KR75_16320
Peptidoglycan biosynthesis and degradation proteins [BR:kvd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   KR75_16320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJA96357
UniProt: A0A264C9H6
LinkDB All DBs
Position
complement(3745663..3746865)
Genome map
AA seq 400 aa AA seqDB search
MMHDAFSLRGLAAGCALLFLVAPAVQAAEQLPDAPSIDARAWILMDYASGKVLSEGNADE
KLDPASLTKIMTSYVVGQAIKAGKIKLTDMVTVGRDAWATGNPALRGSSVMFLKPGMQVS
VEDLNKGVIIQSGNDASIAIADYVAGSQDAFVSLMNGYAKKMGLTNTTFMTVHGLDAPGQ
FSTARDMALLTKAMIHDVPEEYAVHKEKEFTFNKIRQPNRNRLLWSTNLNADGVKTGTTA
GAGYNLVSSATQGDMRLIAVVLGTKTDRIRFNESEKLLTWGFRFYETVTPIKPDATFVTQ
RVWFGDSSEAKLGAGEAGSITLPKGQLKNLKASYTLNQPQLTAPLEKGQVVGTIDFKLND
KTIEQRPLIVMEPVKEGGFFSRMIDFVLMKLHGWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatgacgctttttcccttcgcggcctcgctgcaggttgcgcgctgttatttctt
gtcgcacctgcggtgcaggctgcagaacaactccccgacgccccttcgattgacgctcgc
gcctggatcctgatggactacgccagcgggaaggtgctcagcgaaggcaatgccgatgaa
aaactcgacccggccagtctgacgaagatcatgaccagctacgtggtggggcaggcgata
aaagcgggaaaaatcaagctcaccgatatggtgaccgtcggacgtgatgcctgggcgacc
ggcaacccggcgctgcgcggctcatcggtgatgttcctcaagcccggcatgcaggtctcg
gtggaagatctgaataaaggggtcattattcagtccggtaacgacgccagcattgccatt
gccgactacgtggcgggcagccaggacgcattcgtcagcctgatgaacggctatgccaaa
aaaatggggctgaccaacaccacctttatgaccgtccacggccttgatgcgccgggtcag
ttcagtaccgcccgcgatatggcgctgctgaccaaagcgatgatccacgatgtgccggaa
gagtacgcggtacataaagagaaagagttcaccttcaataaaattcgccagccgaaccgc
aaccgtctgctgtggagcaccaacctcaacgccgatggtgtgaaaaccgggaccaccgcc
ggggccggctataacctggtctcctcggccacccagggtgatatgcgtctgatcgccgtg
gtactggggaccaaaactgaccgcattcgctttaacgagtcagaaaaactgctgacctgg
ggcttccgcttctatgaaaccgtgacgccgattaaaccggatgccaccttcgttacccag
cgcgtatggtttggcgacagcagcgaagcgaaactgggagccggcgaggcgggctctatc
accctgccgaagggccagctgaaaaacctgaaagccagctacaccttaaatcagccgcag
cttaccgcaccgctggaaaaggggcaggtggtcgggactatcgactttaagctgaatgat
aaaaccatcgagcagcgcccgctgatcgtcatggagccggtgaaagagggcggtttcttc
agccggatgatcgacttcgtactgatgaaactccacggctggttcggcagctggttctcc
tga

DBGET integrated database retrieval system