KEGG   Klebsiella variicola DX120E: KR75_21570Help
Entry
KR75_21570        CDS       T03531                                 

Definition
(GenBank) amidase
  KO
K22601  oxamate carbamoyltransferase [EC:2.1.3.5]
Organism
kvd  Klebsiella variicola DX120E
Pathway
kvd00230  Purine metabolism
kvd01100  Metabolic pathways
kvd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kvd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KR75_21570
Enzymes [BR:kvd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.5  oxamate carbamoyltransferase
     KR75_21570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJA97353
LinkDB All DBs
Position
complement(2648776..2650173)
Genome map
AA seq 465 aa AA seqDB search
MTLHHFTIAELQRALHEGELSAREIARQTLDDIARVNPQINAWTEVTAQRMLAEADSIDA
LRREKRPLPPLAGIPYAVKNLFDVAGHTTLAGAELLSDRPPATSDSWAVRQLHSAGALLS
GMLNMDAYAYGFTTENSHFGATRNPHDLSRIAGGSSGGSAAAVAAGLVHFSLGSDTNGSI
RVPASLCGIFGLKPTFGRLSRSGSHPFVASLDHIGPFARRVADLAAVYDALQGRDPADDF
QADKASERTGNLLERGLEGLRCARLGGYFTTWCDDDARAAVDRIAHALGADSELQFADAA
LARSAAFIISASEGGNQYLTDLRHSPERFEPHSRERLLAGAMIPSAWYLQAQRFRRHARQ
AMKSLFSQADVLIAPATPCSATPIGAEEMVINGQPLPVRASMGMLTQPISFLGLPVVTVP
LRTASGKPIGLQLIAAPFNEQACLRAARALEAMGITDARVAESAA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcatcacttcaccattgccgagctccagcgtgcgctgcacgagggcgaactg
agcgcccgggagatcgcccgccagacgctggacgatatcgcccgcgtgaatccgcagatc
aacgcctggaccgaggtcaccgcccagcgcatgctggcggaggccgacagcatcgacgcc
ctgcgccgggaaaagcgccccttgccgccgctggcagggattccttacgcagtgaaaaat
ctgtttgatgtcgccgggcatactaccctcgccggggcggaactgctgagcgaccggccg
ccggcgaccagcgacagctgggcggtgcgccagctgcacagcgccggcgccctgctcagc
gggatgctcaatatggacgcctacgcctacggcttcaccaccgaaaacagccactttggc
gcgacgcgcaacccgcacgatctgtcgcggatcgccggcggttcttccggcggttcggcc
gcggcggtggcggccgggctggtccatttcagcctcggcagcgacaccaacggctcgatc
cgcgtccccgcgtcgctgtgcgggatctttggcctgaaacccactttcggtcgcctttcg
cgctctggcagccatccgtttgtcgccagtctggatcatattggtccttttgcccgccgg
gtggccgacctcgccgcggtgtatgacgccctgcaggggcgcgacccggccgatgacttt
caggctgataaagccagcgagcgcaccggtaatctgctggagcgcggactggaggggctg
cgctgcgcgcggctgggcggctatttcaccacctggtgcgatgacgacgcccgggcggcc
gtggatcggatcgcccacgcgctgggcgccgacagcgagctgcagttcgcggatgccgcg
ctggcccgctcggcggcctttatcatcagcgccagcgaaggcggcaatcagtacctgacg
gatcttcgccactcgccagagcgttttgaacctcactcccgcgagcggctgcttgccgga
gcgatgatcccctccgcatggtatctgcaggctcagcgttttcgccgtcatgctcgccag
gcaatgaaatccctgttcagccaggccgacgtgctgatcgcccccgccaccccatgcagc
gccacgccaataggcgcggaggagatggtaattaacggccagccgctgccggtgcgcgcc
agcatgggaatgctaacgcagccgatctccttcctcggtctgccggtggtgaccgtcccc
ctgcgcaccgccagcggtaagccgattggcctgcagctgattgccgcgccgtttaacgaa
caagcctgtcttcgcgccgcgcgggcgctggaagcgatgggcattaccgatgcccgagtg
gcggagagtgcagcatga

DBGET integrated database retrieval system