KEGG   Ketogulonicigenium vulgare WSH-001: KVU_0371Help
Entry
KVU_0371          CDS       T01909                                 

Gene name
tdk
Definition
(RefSeq) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00240  Pyrimidine metabolism
kvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    KVU_0371 (tdk)
Enzymes [BR:kvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KVU_0371 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_19
Motif
Other DBs
NCBI-GeneID: 12373217
NCBI-ProteinID: YP_005794207
UniProt: F9Y9V9
LinkDB All DBs
Position
complement(419914..420504)
Genome map
AA seq 196 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASYNYLERGMQTYLLTAAFDDRAGVGRIESRIGIGADAD
TYRAGDDLFARIRARQAAGEIACVLVDEAQFLTPDQVWQLARAVDDLRVPVMCFGLRVDF
RGELFPGSATLLALADEMREVRTICHCGKKATMVVRYGPDGTVAHDGDQVVIGGNETYVS
LCRRHWRAAMGEDVPF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctaagctttacttcaactattcgacgatgaatgccggcaagtcgacggtgctgctg
caggcgtcctataactatctggaacgcggcatgcagacctatctgctgaccgccgccttt
gacgaccgcgcaggtgtgggccgtattgaaagccgcatcgggatcggtgcggatgccgat
acctatcgcgcgggcgacgatctgttcgcccgcatccgcgcgcgccaagccgcgggcgag
atcgcctgcgtcttggtggacgaggcgcaattcctgaccccggaccaagtctggcaactg
gcccgcgccgtcgatgacctgcgcgtgcccgtcatgtgttttggcctgcgcgtcgatttt
cgcggcgagctattccccggctcggccacgctgctggcactggccgatgaaatgcgcgag
gtgcgcaccatctgtcattgcgggaaaaaggccacgatggtcgtgcgctatggcccagat
ggcaccgtcgcccatgatggcgatcaggtggtgatcggcggcaatgaaacctatgtgtcc
ctttgccgccgtcattggcgcgccgcgatgggcgaggatgtgcccttttaa

DBGET integrated database retrieval system