KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2462Help
Entry
KVU_2462          CDS       T01909                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00020  Citrate cycle (TCA cycle)
kvl00190  Oxidative phosphorylation
kvl00650  Butanoate metabolism
kvl01100  Metabolic pathways
kvl01110  Biosynthesis of secondary metabolites
kvl01120  Microbial metabolism in diverse environments
kvl01130  Biosynthesis of antibiotics
kvl01200  Carbon metabolism
Module
kvl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kvl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KVU_2462 (sdhA)
   00650 Butanoate metabolism
    KVU_2462 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KVU_2462 (sdhA)
Enzymes [BR:kvl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KVU_2462 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     KVU_2462 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 12375402
NCBI-ProteinID: YP_005796297
UniProt: F9Y7K5
LinkDB All DBs
Position
2604261..2606066
Genome map
AA seq 601 aa AA seqDB search
MAAYTYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEYGEGPPVQRTCAAADRTGHAILHTLYGQSLKQQAEFYIEYFALDLIMSEDGV
CTGVLAWKLDDGTFHVFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNAAGERFMERYAPTYKDLASRDVVSRCMTIE
IREGRGVGPNKDHIYLHLNHLPPETLHERLPGISESARIFAGVDLTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTADNPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGQIVQAGTPNAAPNLHSIAKAFDRFDALRYANGGTTTADLRLEMQRAMQADAAVFRTD
KTLAEGVEKMTAVAAKVADLKVSDRSLVWNSDLMETLELTNLMPNALATIVAAEARKESR
GAHAHEDYPERDDVNWRKHSLAWVEGNTVSLDYRPVHLDPLTTVEEGGIDLKKIAPKARV
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcttacacatacgagacgcatgaatatgacgtcgtggtggttggtgccggtggc
gcgggcctgcgcgcaacgctgggcatggcggaacaaggcctgcggacggcctgtatttcc
aaggttttcccgacccgctcgcatacagttgcggcgcagggcggcattgcggccagccta
gggaatatgggccccgatagctggcagtggcatatgtatgacacggtgaagggcagcgac
tggctgggcgacaccgatgcgatggaatatctggcccgcgaagcgcccaaggcggtctac
gagctggaacattacggtgtgccgttttcccgcaccgaagagggcaagatctatcagcgc
ccctttggcggtcacaccaccgaatatggcgaaggcccgcctgtgcaacgcacctgcgcc
gccgccgaccgtaccggccacgcgatcttgcacacgctttatggccaaagcctgaaacag
caggctgagttctacatcgaatatttcgcgctcgatctgatcatgtccgaagacggtgtc
tgcaccggcgttctggcatggaagctggatgatggcacgttccacgtcttttcggccaag
atggtcgtgctggcgacgggcggttatggccgcgcctatttcagcgcaacctcggcccat
acctgcacgggcgacggcggcggcatggtggcgcgcgcggggctgccgctgcaagatatg
gaattcgtgcaattccaccccacgggtatctatggctcgggctgtctgatcaccgagggc
gcgcgcggcgagggtggttatctgaccaacgcggccggcgagcggtttatggagcgctac
gcccccacctataaagatctggccagccgcgacgtcgtctcgcgctgcatgacgatcgag
attcgcgaaggccgcggtgtcggcccgaacaaagaccacatctacctgcacctgaaccac
ctgccgcccgagacattgcacgagcgtctgcccggtatttcggaatcggcgcggattttc
gccggtgtcgatctgaccaaagagccgatccccgtgctgccgaccgtccactacaatatg
ggcggtatcccgacgaactattggggcgaagtgctgaacccgacggcggataatcccgac
cgtgtgcagccgggtctgatggcggtgggcgaggcgggctgtgcctcggtccacggtgcg
aatcggttggggtcgaattcactgatcgaccttgtggtgttcgggcgtgcggcagccatt
cgtgcgggccagatcgttcaggcgggcactcccaatgccgcgccgaatctgcattcaatt
gcaaaggcttttgatcggttcgacgccttgcgttatgccaatggcggcacgacgaccgcc
gatctgcgattggaaatgcagcgcgccatgcaggccgatgccgccgtgttccgcaccgac
aaaacgctggcagagggggtcgaaaagatgaccgccgttgcggccaaagtcgcggatcta
aaggtaagtgaccgcagccttgtgtggaacagcgatctgatggaaacgctggagctgacg
aacctgatgcccaacgcgctggcgacaatcgtcgccgccgaggcacgcaaggaatcgcgc
ggcgcccatgcgcatgaggactatcctgaacgcgatgacgtgaactggcgcaagcactcg
ctagcctgggtcgaggggaatactgtatccttggattatcgtccggttcatcttgatccg
ctgacgacggtcgaggaaggcgggattgatctgaaaaagatcgcccccaaagcacgggtc
tattaa

DBGET integrated database retrieval system