KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2498Help
Entry
KVU_2498          CDS       T01909                                 

Definition
(RefSeq) alcohol dehydrogenase GroES-like protein
Organism
kvl  Ketogulonicigenium vulgare WSH-001
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD Pyr_redox_2 ADH_zinc_N_2 HI0933_like AlaDh_PNT_C Pyr_redox_3 NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 12375450
NCBI-ProteinID: YP_005796333
UniProt: F9Y851
LinkDB All DBs
Position
2649366..2650385
Genome map
AA seq 339 aa AA seqDB search
MKAVFYTGDKSFELREIARPDPAAGEVEIAVAYNGICGTDLHAYHGAMDARIGHNRVLGH
EMSGRVARLGAGVTGLAVGQPVVIRPLKPCGDCPACNAGLSHICHKLKFLGLDTDGALQD
YWSVPAYAVHPLPETVPLDHAALAEPVAVAAHDVRRSRLAAGEFALVIGGGPIGLLIAMV
ARHAGARVLISEVNPLRIGIAQEMGFDVVNPREANVIDTVNAATGQKGADVVFEVSGTVA
GVELMTDVAASRGRICMVAIHTTRPQVDLFRFFWRELELIGARVYEAEDFDTAIDLIATG
VVDAGRMITDVQDLSQVGAAFAALDGNAKAMKSLIRISG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtcttttacaccggtgataagtcttttgagctgcgcgagattgcgcgccca
gatcccgccgcgggcgaggtcgagatcgccgtcgcctataatggcatttgcggcaccgat
ctgcatgcctatcacggcgcgatggatgcgcggatcggccataaccgcgtgctgggccat
gaaatgtcgggccgcgtcgcgcgccttggcgcgggtgtgacgggtctggctgttgggcag
cccgtcgtgatccgcccgctgaaaccctgcggtgattgtcccgcgtgcaatgcggggctt
tcgcatatctgccacaagctgaaatttcttggcctcgataccgatggcgctttgcaggat
tactggtcggtgcctgcctatgcggtgcatccgctgcccgaaaccgtgccgctggaccac
gccgcgctggccgagccggtcgccgtggcggcccatgatgtgcgccgcagccgccttgct
gcgggcgagtttgcgctggtcatcggtggcggccccattggtctgctgatcgccatggtg
gcgcgccacgcgggcgcgcgtgtgctcatctccgaggtgaacccgctgcggatcggcatc
gcgcaagagatgggctttgacgtcgtgaacccgcgcgaggcaaatgtcatcgacaccgtg
aacgccgctaccgggcaaaagggcgcggatgtggtattcgaagtgtcgggcacggtggct
ggggtcgagttgatgaccgatgtcgccgcatcgcgcgggcggatctgtatggtggccatc
cacacgacccgcccccaggtcgacctgttccgctttttctggcgcgagctagagctgatc
ggcgcccgcgtttacgaggccgaggatttcgacaccgccatcgacctgattgcgaccggc
gtcgtcgatgcgggccgcatgatcaccgatgtgcaggacctctcgcaagtcggcgcagct
tttgcggcgctggacggcaatgcgaaggccatgaaaagcctgatccgcatcagcggctag

DBGET integrated database retrieval system