KEGG   Ketogulonicigenium vulgare WSH-001: KVU_2498
Entry
KVU_2498          CDS       T01909                                 

Definition
(RefSeq) alcohol dehydrogenase GroES-like protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kvl  Ketogulonicigenium vulgare WSH-001
Pathway
kvl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KVU_2498
Enzymes [BR:kvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KVU_2498
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KVU_2498
    1.1.1.-  
     KVU_2498
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD Pyr_redox_2 ADH_zinc_N_2 HI0933_like AlaDh_PNT_C Pyr_redox_3 NAD_binding_8 FAD_binding_3
Other DBs
NCBI-GeneID: 12375450
NCBI-ProteinID: YP_005796333
UniProt: F9Y851
LinkDB
Position
2649366..2650385
AA seq 339 aa
MKAVFYTGDKSFELREIARPDPAAGEVEIAVAYNGICGTDLHAYHGAMDARIGHNRVLGH
EMSGRVARLGAGVTGLAVGQPVVIRPLKPCGDCPACNAGLSHICHKLKFLGLDTDGALQD
YWSVPAYAVHPLPETVPLDHAALAEPVAVAAHDVRRSRLAAGEFALVIGGGPIGLLIAMV
ARHAGARVLISEVNPLRIGIAQEMGFDVVNPREANVIDTVNAATGQKGADVVFEVSGTVA
GVELMTDVAASRGRICMVAIHTTRPQVDLFRFFWRELELIGARVYEAEDFDTAIDLIATG
VVDAGRMITDVQDLSQVGAAFAALDGNAKAMKSLIRISG
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaaagcggtcttttacaccggtgataagtcttttgagctgcgcgagattgcgcgccca
gatcccgccgcgggcgaggtcgagatcgccgtcgcctataatggcatttgcggcaccgat
ctgcatgcctatcacggcgcgatggatgcgcggatcggccataaccgcgtgctgggccat
gaaatgtcgggccgcgtcgcgcgccttggcgcgggtgtgacgggtctggctgttgggcag
cccgtcgtgatccgcccgctgaaaccctgcggtgattgtcccgcgtgcaatgcggggctt
tcgcatatctgccacaagctgaaatttcttggcctcgataccgatggcgctttgcaggat
tactggtcggtgcctgcctatgcggtgcatccgctgcccgaaaccgtgccgctggaccac
gccgcgctggccgagccggtcgccgtggcggcccatgatgtgcgccgcagccgccttgct
gcgggcgagtttgcgctggtcatcggtggcggccccattggtctgctgatcgccatggtg
gcgcgccacgcgggcgcgcgtgtgctcatctccgaggtgaacccgctgcggatcggcatc
gcgcaagagatgggctttgacgtcgtgaacccgcgcgaggcaaatgtcatcgacaccgtg
aacgccgctaccgggcaaaagggcgcggatgtggtattcgaagtgtcgggcacggtggct
ggggtcgagttgatgaccgatgtcgccgcatcgcgcgggcggatctgtatggtggccatc
cacacgacccgcccccaggtcgacctgttccgctttttctggcgcgagctagagctgatc
ggcgcccgcgtttacgaggccgaggatttcgacaccgccatcgacctgattgcgaccggc
gtcgtcgatgcgggccgcatgatcaccgatgtgcaggacctctcgcaagtcggcgcagct
tttgcggcgctggacggcaatgcgaaggccatgaaaagcctgatccgcatcagcggctag

DBGET integrated database retrieval system