KEGG   Klebsiella variicola DSM 15968: SP68_07290Help
Entry
SP68_07290        CDS       T03641                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00564  Glycerophospholipid metabolism
kvq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SP68_07290
Enzymes [BR:kvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SP68_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_oxidored FAD_binding_2 DAO_C FAD_binding_3 NAD_binding_8 Pyr_redox_2 HI0933_like Thi4 Pyr_redox 3HCDH_N GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AJE89066
UniProt: A0A0B7GM56
LinkDB All DBs
Position
complement(1549994..1551616)
Genome map
AA seq 540 aa AA seqDB search
MTGRLDSEVIIIGGGATGAGIARDCARRGLRTLLIERHDIATGATGRNHGLLHSGARYAV
TDNESARECISENRILRRIARHCIEPTNGLFITLPEDDMAWQQTFIDACQQAGIEATPLS
PQDALRQEPAVNPTLLGAVQVPDGTIDPFRLTAANMLDAREHGAQILTGCEVTGLLRQGD
RVCGVQVYDRQLHQARTLYAGVVVNAAGIWGQRIAEYADLRITMFPAKGSLLILDHRINN
LVINRCRKPADADILVPGDTISLIGTTSMHIPYDDIDDNRVTTAEVDTLLREGEKLAPIM
GRTRILRAYSGVRPLVASDNDPSGRSVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGNTTPCSTAETPLPGSQEPTESTLQKIISLPTPLRGSAVYRHGDRTPAW
LGDSRQHRSLVCECEAVTAGEVKYAVENLAVNTLLDLRRRTRIGMGTCQGELCACRAAGL
LQRFNVTTPAQSLTQLSAFLNERWKGVQPIAWGDALRESEFTRWVYLGLCGLPQEHQDEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacgtcttgatagcgaggtcattatcatcggcggcggagcaaccggcgccggt
atcgcccgcgactgcgcccggcgcggattacgcacgctgctcattgagcgccatgatatc
gccaccggggccaccggccgtaatcatggactgctgcacagcggcgcccgctatgcggtg
accgacaacgaatccgcccgcgaatgcatcagtgagaaccgcatcctgcgccgcatcgcc
cgccactgcattgaaccgaccaatgggctgtttatcaccctgcctgaagatgacatggcc
tggcagcaaacctttatcgacgcctgtcagcaggctggcatagaggccacgccgctctcg
ccgcaggacgcgctgcgccaggagcccgccgtcaacccgacgctgctgggcgcagtgcag
gtcccggacggcaccatcgacccgtttcgcctcaccgcagccaatatgctcgacgcccgc
gaacacggcgcgcagatccttaccggctgcgaagtaacaggcctgctgcgccagggcgat
cgcgtctgcggcgtccaggtatatgaccgtcaacttcaccaggcccgcacgctgtacgcc
ggggtggtggttaacgccgccgggatctgggggcagcgcattgcggaatatgccgacctg
cgcatcaccatgttcccggcgaagggatcgctgttgatcctcgaccaccggattaacaac
ctggtgatcaaccgctgccgtaagccggccgacgccgatattctggtgcccggggatacc
atctcgctgatcggcaccacctcaatgcatattccttatgacgacattgacgacaaccgg
gtaacgacggcggaagtcgataccctgctgcgcgaaggcgaaaagctggcgccgatcatg
ggccgcacccggatcctccgcgcctactccggcgtccgcccgctggtggccagcgataac
gatcccagcgggcgcagcgtcagccgcggcatcgtcctgctcgaccatgcccagcgtgac
ggtatggaaggcttcattactatcaccggcggcaagctgatgacctatcgcctgatggcc
gagtgggccaccgacgccgtctgtcgtaagctgggaaacaccaccccctgtagcacggcc
gagaccccgctgcccggttcacaggagccaacggaaagtaccctgcaaaaaattatctcc
ctccccaccccgctgcgcggctcggccgtctaccgtcacggcgatcgcactccggcctgg
cttggcgacagccgccagcaccgtagcctggtctgcgaatgcgaagccgttaccgctggc
gaagtgaaatacgcggtggaaaatctggcggtcaacaccctcctcgacctgcgccgccgc
acccggattggcatgggcacctgccagggggaactctgcgcctgccgcgctgccggactg
ttgcagcgctttaacgtcaccacccccgcgcagtcattaacccagctctcggcgtttctc
aatgaacgctggaagggcgttcagcccatcgcctggggcgatgcactgcgcgaaagcgaa
tttacccgctgggtctacctcggcctgtgcggactgccacaggagcaccaggatgaagtt
tga

DBGET integrated database retrieval system