KEGG   Klebsiella variicola DSM 15968: SP68_11905
Entry
SP68_11905        CDS       T03641                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00052  Galactose metabolism
kvq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SP68_11905
Enzymes [BR:kvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SP68_11905
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Methyltransf_25 2-Hacid_dh_C 3HCDH_N MTS UDPG_MGDP_dh_N ELFV_dehydrog Methyltransf_31 PrmA Methyltransf_11 Pyr_redox_2 FAD_binding_2 CoA_binding Methyltransf_24 Shikimate_DH Met_10 Pyr_redox Peptidase_U32
Other DBs
NCBI-ProteinID: AJE89933
LinkDB
Position
complement(585965..587008)
AA seq 347 aa
MKSVVIHAEGNVGVEERPIPTLQTEHDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKALGATRVFNSREMSGQAIQQALEAIQFDQLVLETAGTP
QTVTLAIEAAGPRAQLALVGTLHHDLTLPAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtcggcgttgaagaacgccctatccct
acgctgcaaacggaacacgatgtcctggtcaaagtggtcagttccggattatgcggctcc
gacatcccgcgcattttcgccaaaggcgcgcattactaccctattacgctggggcacgaa
ttcagcggctatgtggaatcctacggcgcggcggtaactgatctgcagcccggcgatgcc
gtcgcctgcgtgccactgctgccctgctttcagtgtccgcagtgccagcgcgagtatttc
tctttatgtaaacaatatcagtttgtcggctcacgcagcgaaggtggcaacgccgaatat
gtggtggtgaagcgcgccaacctgttccgcctgccggatcagatgccgattgatgacggc
gcgtttatcgagccgataaccgttggcctccacgccttccacctggcacagggttgcgaa
ggtaaaaacgtgattattatcggtgcgggcaccattggcctgctggcattacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaaactggagctg
gccaaagcccttggcgcgacccgagtgttcaacagccgcgaaatgagcggccaggcgatt
cagcaggcgctggaagccattcagttcgaccagttagtccttgagaccgccggcacgccg
cagaccgtcacgctggcgattgaggccgccggtccgcgggcgcagttggcgctggtcggc
acgcttcatcacgatttaaccctcccggccgccaccttcgggcagatcctgcgtaaagag
ttgaatattgtcggtagctggatgaattactctggtccgtggccaggagaagagtggcaa
acggccacccgcctgctgacagaaaaacgcctgcagctggcaccgctaatagcccaccgc
ggtgacgcggagagctttgcgcgtgaagttcaggcgctaaacggcgcaccgatgcagggt
aaaatcctgctcaaactctcctga

DBGET integrated database retrieval system