KEGG   Klebsiella variicola DSM 15968: SP68_13105Help
Entry
SP68_13105        CDS       T03641                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00564  Glycerophospholipid metabolism
kvq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SP68_13105
Enzymes [BR:kvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SP68_13105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AJE90158
UniProt: A0A2W7T9E7
LinkDB All DBs
Position
complement(355775..357283)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVTIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISESLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLNAE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gatgccgccgggcggggtttatccgtactgatgctggaagcgcgcgatctcgcctgcgct
acctccagcgccagttccaaacttatccacggcgggctacgctacctcgaacactatgag
ttccgcctggtcagcgaagcgctggccgagcgtgaagtgctgttaaaaatggctccgcat
atcgccttcccgatgcgctttcgtctcccgcatcgtccgcatctgcgtccggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctgccgggctcc
accggcttgcgttttggcgcagaatcggtacttaagccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggttgtc
cgcaaaggcggcgaagtgcggacccgcactcgcgccatctcggcaaaacgagagaacggc
ctgtgggtggtggaagcggaagatatcgatagcggcgagaagtttacctggaaggcgcgc
ggtctggtcaatgccaccggtccatgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccttacggtatccgcctgatcaagggcagccacatcgtggtgccgcgagtgcat
actcagaagcaggcctacattctgcaaaacgaagataaacgtattgtgtttgttatcccg
tggatggatgagttctccatcatcggcacgacggacgtcgagtataagggcgatccgaaa
gcggtgaccattgatgataaagagattaattacctgctgaacgtctataacgcgcacttt
aaaaagactctcagccgggacgatatcgtctggacctactccggcgtccgtccgctgtgt
gatgacgagtcggattcgccgcaggcgatcacccgcgactacacgctggatattcacgat
gagaacggccaggcgccgctgctctccgtcttcggcgggaagctgaccacctatcgcaaa
ctggccgagcatgcgctggaaaaactgactccctattacaaagggatcggcccggcatgg
accaaaaccgcggtgctccccggcggcgatatcggcggcgaccgcgacgactatgcagca
aaactacgccgtcgcttcccgttcatcagcgaatcactggcccgccattatgcccgcacc
tacgggagcaacagcgagtggatcctgaaggaagccagcgccctgagcgatctgggggaa
gatttcggccatgagttttatgaagccgagctgaaatatctggttgagcacgaatgggtg
cgcagcctggatgacgccatctggcgtcgtaccaaacagggcatgtggctgaatgccgag
cagcaagcgcgcatcagcgaatggctggcgcagcatgcgggaaagtctgaactgtcgtta
gcgtcctga

DBGET integrated database retrieval system