KEGG   Klebsiella variicola DSM 15968: SP68_13275Help
Entry
SP68_13275        CDS       T03641                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00250  Alanine, aspartate and glutamate metabolism
kvq00410  beta-Alanine metabolism
kvq00640  Propanoate metabolism
kvq00650  Butanoate metabolism
kvq01100  Metabolic pathways
kvq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SP68_13275
   00650 Butanoate metabolism
    SP68_13275
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SP68_13275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SP68_13275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kvq01007]
    SP68_13275
Enzymes [BR:kvq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SP68_13275
Amino acid related enzymes [BR:kvq01007]
 Aminotransferase (transaminase)
  Class III
   SP68_13275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJE90190
LinkDB All DBs
Position
318325..319590
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNEAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYQVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARILK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgccatccgaaa
gtggtcgccgcggtcgccgatcagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaggcggttgagaacgcagtgaaaatt
gcccgcgcttacaccggccgccctggactaattactttcggcggcggcttccacggccgt
acttttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggccg
ttcccgggatcggtgtatcacggcgtttatcccaatgaggcgcacggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggaccaggtagcg
gccatcatcctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgatctgtgcgatacccacggtattctgctgatcgctgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatcaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggcttcccgctgtcgggcgttgtcggt
cgcgccgaggtgatggatgcgccagccccaggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtcattgccgaagagcagctgtgt
caacgggctgaacagctgggtagccatctgcaggaggtgctcaaccaggcgcgcgccacc
tgcccggcgatcgttgatgtccgtggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaactggcgagccgtcgccggagttcacccgccttgtgcaacagaaagcgcaggaa
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatccccgacgcccagttctcgaaagcgctggatattctggcgcgcatcctgaag
agctaa

DBGET integrated database retrieval system