KEGG   Klebsiella variicola DSM 15968: SP68_16440Help
Entry
SP68_16440        CDS       T03641                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SP68_16440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kvq02000]
    SP68_16440
Enzymes [BR:kvq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SP68_16440
Transporters [BR:kvq02000]
 Other Transporters
  Pores ion channels [TC:1]
   SP68_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AJE90774
UniProt: A0A2N4Z7X7
LinkDB All DBs
Position
complement(5142405..5143073)
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKSMLAPAALKKVHPLGKSPVLEDNGY
VLAESGAILEYLQETWDSGGLLKPQAIEDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRSLGALLGKGIQKAWLDPQLATHARFIDDHLATRPWFAGERLSMADIQMSFPVM
ALLARGGVHDLVHIEAWRQRVEQRPAWQRAIERGGPFTLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtacaccatcttaatcaatcacgatcgcaacgcgtactgtgggcactggaa
gagctgcagctgccttatcagatagtccgctatcagcgggaaaagtcgatgctggcgccg
gcggcgctgaagaaagtccatccgttggggaaatcgccggtgctggaagacaacggctat
gtgctggcggagtccggggccattctcgagtatttgcaggagacctgggacagcggcggg
ctgctgaagccgcaggcgatagaggacaaactgcagtaccgcttctggctgcactatgcc
gaaggctcgctgatgccgctgctgttaatgaagctggtgttcgccagcctgggtaaaccc
cctgtgccctttggcgtccgctcgctgggcgccctgctgggcaagggcattcagaaagcg
tggctggatccccagctggccacccatgcgcggtttattgacgaccatcttgccacgcgg
ccatggtttgccggcgagcgtctaagtatggccgatatccagatgagcttcccggtgatg
gcgctgttggcgcgcggtggcgtgcatgaccttgtccatattgaggcctggcgacagcgg
gtggagcagcgtccggcctggcagcgggccatcgagcgcggcggtcccttcaccttaccc
ggcgcctga

DBGET integrated database retrieval system